SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019277 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019277
Domain Number 1 Region: 302-501
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000428
Further Details:      
 
Domain Number 2 Region: 197-268
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-19
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 83-177
Classification Level Classification E-value
Superfamily PX domain 0.0000000144
Family PX domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019277   Gene: ENSTNIG00000016186   Transcript: ENSTNIT00000019506
Sequence length 740
Comment pep:known_by_projection chromosome:TETRAODON8:16:2907642:2915114:1 gene:ENSTNIG00000016186 transcript:ENSTNIT00000019506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVQEKPTAQARGDDITEHPAEPLLRSCVSTASMKVKNVKKLTFPRGHFPRLAECAHFHYE
TVDFGNVQSALVEGQSEGAKAGTDSKEPLFLVQITCQGRNWLIKRSYEDFRVLDKHLHLC
IYDRRYSELSELPRLDSLKDAAETVTRMLATYLSRFSAIADNKINCGPVLTWMEIDNKGN
HLLVSEEASINVPAIAAAHVTKRYTAQASDELTFEVGDIVSVIDMPPKEDTGWWRGKHGF
QVGFFPCNCVELINDKIPDSVQNSVPKPVCKKHGKLITFLRTFMKSRPPPQKLRQRGILK
ERVFGCDLGEHLHNSGHEVPQVVRSCAEFIEKHGVVDGIYRLSGISSNIQKLRHEFDSEQ
IPDLTRDVFRQDIHSVGSLCKLYFRELPNPLLTYQLYDRFSEAVSAATDEERLVKIHNVI
QQLPPPHYRTLEYLMRHLSHLATFSSTTNMHTKNLAIVWAPNLLRSRQIESACFSGTAAF
MEVRIQSVVVEFILNNTEALFSPKLNAIIRESAGNNTLSRPKSLLVCSPSTKLLSLEEAQ
ARTQAQLSSPATTPCLTHSDYIEVGEGPGALLGKFHTVIELPMESCKRPPAKAKKSPVGN
WLSFFHLGKSQSVSKRRLRRHPSEPNEIKSMVLPGGKGNSGTLRSTKSEESLASLHVLEG
EPPPPSHRRPRSTSEAVSAASRGEAHKSRSREDHKALTLNERRHGADRIHACVPEDDLDL
CPPAAGISNLDFDPMSFQCA
Download sequence
Identical sequences H3DFI3
ENSTNIP00000019277 ENSTNIP00000019277 99883.ENSTNIP00000019277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]