SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019322 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019322
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.86e-85
Family Protein kinases, catalytic subunit 0.00000279
Further Details:      
 
Domain Number 2 Region: 312-679
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.13e-70
Family Regulator of chromosome condensation RCC1 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019322   Gene: ENSTNIG00000016229   Transcript: ENSTNIT00000019551
Sequence length 691
Comment pep:known_by_projection chromosome:TETRAODON8:16:3968145:3972802:-1 gene:ENSTNIG00000016229 transcript:ENSTNIT00000019551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKYEKIKVVGRGAFGIVHLCRRRNDGAYVILKEIPVEQMSRDERLAAQNECQVLKLLNH
PNIIEYYENFLEDKALMIVMEYAPGAGGTLADYIQKRCNSLLDEDTILHFFVQILLALYH
VHNKFILHRDLKTQNILLDKHQMIVKIGDFGISKILVSKSKAYTVVGTPCYISPELCEGK
PYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILNM
LNLDPSKRPQLNEIMALPICIRPLLNLYTDIGSVKMRRIEKPLSTVQTGRQGRPGGRVPT
IRSRAGGKVHSLPLSSVYTWGNGISAPLRLPMLNTEVLQVSLGRTQKMGVTKAGRLITWE
APSVGSGEVSLPGAVEQMQPQFISRFLEGQSGVTIRSVSCGDLFTTCMTDRGIIMTFGSG
SNGCLGHGNFNDVTQPKIVEALLGYELIQVSCGASHVLAVTNEREVFAWGRGENGRLGLG
NQDTHNSPQQVCLPGEFEANRVVCGVDCSIVISSQYSILACGSNRFNKLGLDSITTGEEP
SPSHQVEEVTSYRPVRSEPLCSETIVHIDIGTAHSVAVTEKGECFTFGSNQHGQIGCSSR
RSSRVPYQVPDLQGITLAACGDAFTLAIGSEGEVYTWGKGVRGRLGRKEEDCGIPKLQLD
ESHPYVVTSVACFNGNSLLAVKQIMIVPLPY
Download sequence
Identical sequences H3DFM8
ENSTNIP00000019322 99883.ENSTNIP00000019322 ENSTNIP00000019322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]