SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019340 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019340
Domain Number 1 Region: 179-444
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.33e-47
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 7-138
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.08e-37
Family Ankyrin repeat 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019340   Gene: ENSTNIG00000016247   Transcript: ENSTNIT00000019569
Sequence length 447
Comment pep:known_by_projection chromosome:TETRAODON8:16:4155233:4161121:1 gene:ENSTNIG00000016247 transcript:ENSTNIT00000019569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSSVVDMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVGKLIQCKADTNAANEHGNTPLHYACFWGQDQVAEDLV
TNGAQVSICNKYGETPLDKGKPHLRELLREKAEKMGQNLTKIPFKDTFWKGTTRTRPRNG
TLNKHAGIDYKQLSLLARINENQSGELWQGRWQGNEIVVKVLKVRDWTTRKSRDFNEEYP
KLRIFSHPNVLPMLGACQSPPAPHPIIITHWMPYGSLYNILHEGTNFVVDQTQAVKFALD
IACGMAFLHTLEPMIPRHYLNSKSVMIDEDMTARISMADVKFSFQCPGRMYSPAWVAPEA
LQKKPEEINRRSADMWSFAILLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
ICKLMKICMNEDPAKRPKFDMIVPILE
Download sequence
Identical sequences H3DFP6
ENSTNIP00000019340 ENSTNIP00000019340 99883.ENSTNIP00000019340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]