SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019345 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019345
Domain Number 1 Region: 560-757
Classification Level Classification E-value
Superfamily HCP-like 1.66e-27
Family HCP-like 0.0012
Further Details:      
 
Domain Number 2 Region: 771-881
Classification Level Classification E-value
Superfamily HCP-like 0.000000000061
Family HCP-like 0.0073
Further Details:      
 
Domain Number 3 Region: 447-548
Classification Level Classification E-value
Superfamily HCP-like 0.0000000458
Family HCP-like 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019345
Domain Number - Region: 195-311
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0396
Family Laminin G-like module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019345   Gene: ENSTNIG00000016251   Transcript: ENSTNIT00000019574
Sequence length 934
Comment pep:known_by_projection chromosome:TETRAODON8:16:4570380:4574937:-1 gene:ENSTNIG00000016251 transcript:ENSTNIT00000019574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKIQFSCDKPASVQLDCVVTFDTGITSTYFLKRWRCVPGDPKIQILVLKLPDRLVYRADA
VVPASEDVLSCILLASVRHGGLKESVAAQGVAHLQLQPNFDRPVKEHRLCFTWSARMLQL
TRRFSIQRCPLERETVHLLSSIYASTGEIFGITRTLEPFISRYLEHTRVKAIAFPWCMFS
IWVLVTRHCQNELCGIFHHIDSENNYATPSLFLKASGQLHIQMKGEYEESAFTSAFQVPL
RQWCQIGVTIQGAVATVSMLCVDEEQRTFHSTEHMFGHVVLDDTVGYFVIGGGKYMRGVE
GYFGPFVYYRNRIAPHKAVIPDVIRRVNLTGWLQTCQTFQLEMTVKINGYSLAAEYEASN
TCLDVFREWMVKDRQTLNSQCGVWEETAPRRKKTAKLAKFLAQKHGKTRSLCRRISLSAV
GRALYSLSLQKLEEAGTIATISRTLPLLLQAGCLGETRALYMSSVLYSAELGVRKQPRKV
WLLALLAAQRDNRLALLQLGHMHHQGVHGLPVDPDLAYAYYANIAQQTTLDRHNPSSAQT
FVEAIYLNDDETLSQQTNEKHHIFQWLRLQARRGAAEAEQALASMLFWGQQGVTQNIRKA
VRHYERGAVQLEDPASMYDYGIVLLQGQGVEKDVPKALTFLEKAMDQGFVPAINALAWYY
ERFQQDYRRAVELWERADLLLSPDAALNLGFVHSQGLYPGKAADQFLAYKYYMKAAERGH
IRGAVSLAEVWTTGIAGLVGRRPEDALLWAKWAAEHNGYLGSHLRKALNSYLERDMFTSL
LYYTMAAESGYAAAQFNVAYLCEQHSQGLLNHDSASSCMWKYYNLTIQSQQPDTYALIRM
GDLLHEGHKDPFPAAEMYMKAALRNDPQGWYSLGLLVEEGFRLPLSVLVELGLSELYLAD
RSLLLRTLYSRCRDSENTDSYLPCSLALFSVRLQ
Download sequence
Identical sequences H3DFQ1
ENSTNIP00000019345 ENSTNIP00000019345 99883.ENSTNIP00000019345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]