SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019364 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019364
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000107
Family Ankyrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019364   Gene: ENSTNIG00000016270   Transcript: ENSTNIT00000019593
Sequence length 699
Comment pep:known_by_projection chromosome:TETRAODON8:16:4896287:4900794:-1 gene:ENSTNIG00000016270 transcript:ENSTNIT00000019593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEIIELLLSYNVYVGDALLHAIRKQVVGAVELLLNHKKPHGEKQVSLKKVLSVLLDRHFS
DFTPDITPIILAAHINNYEIIKLLLQRGVSIPQPHAVHCNCMECVSCSDVDSLRHSRSRL
NIYKALASPSLIALSSEDPFLTAFKLSWELKELSTVENEFKSEYGELSRMCKQFAKDLLD
QTRSSKELEIILNYRDDSNPLLDENPNDLARLKLAIKYSQKEFVAQPNCQQLLASRWYDE
FPGWRRRHWAAKLLICIFIGLLFPLLCIAYLISPKSRYGLFIRKPFIKFICHTASYLTFL
FLLFLAAQHIASPLCDLQGPPPTTVEWMILPWVIGFIWNEIKQMWDSGFQDYIGDWWNLV
DFIMNSLYIATISLKIIAYVKYSEQKHRNDWEMWHPTLVAESLFAIANIFSSLRLICLFT
VNSHLGPLQISLGRMLLDILKFFFIYWLVLLAFANGLNQLYFYYETERTNKCKGIHCIQQ
NNAFSTLFDRVECLYWRIFGLISLNVTKVEREHEFTEFVGSTMFGAYNVISLVVLLNMLI
AMMNNSYQHIANHADIEWKFARTKLWMSYFEEGGTLPAPFNIIPSPKSVYYLFAWIKKHL
FKRRSAKRLETFETLGRRAAENVRINHEYQKVLKNLVRRYVAAVIRDAKTERSLTEENFK
ELKQDISSFRYEVLGMMKSKPRSQISSKVASSTLAYPGN
Download sequence
Identical sequences H3DFS0
ENSTNIP00000019364 99883.ENSTNIP00000019364 ENSTNIP00000019364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]