SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019370 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019370
Domain Number 1 Region: 1614-1741
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-35
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 2337-2461
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-34
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 189-309
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-32
Family Cadherin 0.00085
Further Details:      
 
Domain Number 4 Region: 1820-1944
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-32
Family Cadherin 0.00093
Further Details:      
 
Domain Number 5 Region: 406-521
Classification Level Classification E-value
Superfamily Cadherin-like 7.59e-31
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 1044-1173
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-29
Family Cadherin 0.0013
Further Details:      
 
Domain Number 7 Region: 2132-2252
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-28
Family Cadherin 0.0022
Further Details:      
 
Domain Number 8 Region: 1722-1832
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 9 Region: 2563-2672
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 828-938
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-24
Family Cadherin 0.0028
Further Details:      
 
Domain Number 11 Region: 1374-1500
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 12 Region: 1491-1619
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-23
Family Cadherin 0.0045
Further Details:      
 
Domain Number 13 Region: 518-624
Classification Level Classification E-value
Superfamily Cadherin-like 8.38e-23
Family Cadherin 0.00065
Further Details:      
 
Domain Number 14 Region: 1165-1270
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-21
Family Cadherin 0.0037
Further Details:      
 
Domain Number 15 Region: 2665-2768
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 16 Region: 734-846
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-19
Family Cadherin 0.0077
Further Details:      
 
Domain Number 17 Region: 625-727
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-19
Family Cadherin 0.0014
Further Details:      
 
Domain Number 18 Region: 1925-2033
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-19
Family Cadherin 0.0021
Further Details:      
 
Domain Number 19 Region: 2448-2569
Classification Level Classification E-value
Superfamily Cadherin-like 8.77e-19
Family Cadherin 0.0043
Further Details:      
 
Domain Number 20 Region: 941-1056
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-18
Family Cadherin 0.0026
Further Details:      
 
Domain Number 21 Region: 302-410
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-18
Family Cadherin 0.0034
Further Details:      
 
Domain Number 22 Region: 2242-2341
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000871
Family Cadherin 0.0028
Further Details:      
 
Domain Number 23 Region: 113-201
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000694
Family Cadherin 0.0079
Further Details:      
 
Domain Number 24 Region: 1312-1386
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000171
Family Cadherin 0.0037
Further Details:      
 
Domain Number 25 Region: 2041-2144
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000186
Family Cadherin 0.0046
Further Details:      
 
Domain Number 26 Region: 2765-2867
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000385
Family Cadherin 0.0019
Further Details:      
 
Domain Number 27 Region: 24-98
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000485
Family Cadherin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019370   Gene: ENSTNIG00000016276   Transcript: ENSTNIT00000019599
Sequence length 3212
Comment pep:known_by_projection chromosome:TETRAODON8:16:4982164:5026208:-1 gene:ENSTNIG00000016276 transcript:ENSTNIT00000019599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRIVLIICVALELVTFHSPMVLGTLELQLDEEQPAGTVVGDISAGLPPGVTATLFFISDH
EGTGVSTDLHIDESTGIIQTAKILDREVRDRYNFIAVTMTGTAIGTRFPLEPAVDADQGQ
LTTQGYLIKDGNVGQAFTLETRRGSNGVLYLDLVVNTILDREKRSTYTLSLEAFDGGSPK
RTDVMSLDITVQDINDNAPVFNQSRYHAIISENLQPGSNILQVFATDDDEGDNGKVLYEI
NRRQSDPDRYFVIDSQSGVITLNKPLDFEMKRVHELVVQAQDNATQPEVSNAFVTIHVRD
YNDNQPTMTIIFLSEDGSPRVSEGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFAL
TTKDNIIYLICVDRILDREERDTYELRVMATDSGTPPLRAESSFIIQVTDVNDNPPLFDQ
PVYRQVIPEVVFPGSFVLQVTARDKDHGPNGDITYSLFQDQGAHSKWFSIDSVTGIITTD
SQLDYEKNPNPSITVVATDGGKPPMSSTALVNIVLQDINDNEPVFEKHFYNVSIKENTAP
GTCILEVTARDADGGSFGSISYSLGSGIKSASPSQFTVGKETGQICTTAVLDRDQGPASF
DFTVTAVDGGGLSSVAYVKVDLVDINDNRPTFYPVNYAVSLSTQSAPGTSVVRVMAYDLD
SGENGRITYKTAPGGASPYFTLNKDTGVISLSRSVFGKANSVIPMIISAQDGGGLVSFTN
ARVNISVVAGLVAPPVFEHTQYYFSVPEDVLRGTVVGIVRASVKTDSSRDISYTISSGDP
VGYITVDPDSGALRTSLPLDHEAQPSLDLEVQARSGNPPAFGQTRVHISITDINDNPPVF
SPSSYESLLLPEPTEMGTVVYRVQAEDQDSGANGQLSFDLYSPSGTQRSFSIDRSSGEIR
LVGSLRYESTPRYDLQVIAKDSGVPQLSATFVLVVHVQAENDHGPVFDTLSYRVELKEGT
PINKRFLQVRALNRETPGSGYSSPLSYHLRPDGDSAAFGIASDSGWLFVKSTLDREVKDM
YLLTVLATQGHGQLKKTGSATVRVSLTDENDNSPRFTQDRVFMAVKENLPAGTGFGHVSA
ADRDAGPNGRLSYRLLHPDRHFQINPHTGELYLFLFASPGEMSTKTVLDREQQSSYQLVV
LVQDGGSPPRSATGTAFITVLDDNDNDPAFTHSPSGKKLILQVTESQSSGVLVGTLQAKD
PDEGENGTVFYSLIGPRADRFSLNPNSGELHSSSALSHSERAEYSLMVTATDRGQPPRST
SCSLTIQTVDFVDINGRDGHTYLKVTFNSVEQTAPGSIIGSVRHQGGTSKEGEVTYTVIG
GTDRDGTFVVDRLTGDVLLARPLDYEQYSRYSLQIEVDDLSQVMPSSTLVHLNIEVEDSN
DHAPQFPEDPITVVIPESMESGSSVYTFQATDKDGSEANSELSYSILHQWPSAHGLLSLD
SSTGVLSIAQKLDHEVTPSLILVVKATDSAHDASLRRWSSVTARVYITDENDNPPVFRSP
ASVSVMEDQPVGFVALYVKATDADEGENGRVTYRIQSGNTGGKFSLNPNTVFGLAYVIHP
TEIEIASLHALLFKAGSLSILKPLDREEQDIFNLTITAEDHGMPQQSSAQLLCVHVIDVN
DEVPWFEETQYEAQVSENQPSGTSVLTVSASDLDLGPNGQVTYSGISEEDFNINPVTGVI
TTTKALDRELREYYTVTVYAKDGGLPPNYAKATVRIRVLDENDNTPYFGRLYYSIEVPEN
LEAMPLFTLRANDQDSGKSGIINYKITVGDSSGDFHLDKLSGVLSTSRPLDREVRARYML
TVTAQDQGHPPLSSTATVEVSVLDINDHSPQFESSAYTADIPEDIPIGSHVLDVKATDLD
QGPNSRVLYFLSSSSHSSFIIDQDTGSIITAAPLDREKIASYTFKVCATDSSPLNPRNST
AEVTISVQDVNDNAPFFIQDPLIVNVSIGSVSSRRVLATMRAEDKDFGANGSVFYRFANP
VKGFTINSLTGDIQATEKLQSLSQSQRTLIVQAMDQGNPAQSSLGVVIIYLREQIYRGIR
FSRTTRDVTLQENALKGTVITQTQARYPDGSQIGITYSIFNGNRMQSFGINTITGEIWVQ
KSEGLDFEETPKLRLVVKAESASSSSYMAVNIILQDVNDNLPRFQLQNYVAYIREAQGYD
FPIIQVAAVDLDQGQNGQVIYSLRSSSRSGLFKIDPLTGSITTAAIMDREIWTETKLVVT
ATDRGTPRLAGSATLTVIITDLNDNSPMIPLPQEIHVPENTLIGTVITRVTGNDVDSGPA
LFYTLNLDVNSQDMFGIHRYGGGVSLTGPLDYEERTWYTVTVSTSDSKHHSEANLTVLVD
DVNDNAPTFTQDMYQVTVAEHLPAGSAVVTVTATDRDSGDNGKIIYRVMSSTKGIFYIDP
SNGTLFTNQKTTFDAENPSILVVVEARDQGAPSLSTIATVHVHVTDVNDNAPIFHQSEYR
VVSENDIPGSTILTLEAVDGDVTRDNCGFDFAIASGNSGNTFQIESSVRFLEGHGFQTVG
SLVLVEELDFEAVPSYNLTVVVSDRGIPQRSSVLILISVLDTNDNPPAFNRAEYSVVLSE
GVVVGTEILHLSATDPDSAPNGEVQYSICSGDETEMFHVDRWTGALRLQRALASESRSSH
VIIVQATDGQGQYALAPVNIEVKDINDNRPFFPLKLLTASIRENKPQNALVTVLHAVDHD
KGVFGKLNYYMLDKSSGGKETFSINQTSGEVRTRCSFDFEKVDSFSFVAVAMDAGNYSAT
VTVQVYVTGEDEYDPVFTSSDFSFKVPEGAKKGQIIGKVQAQDEDGGVDGIVLYSLVHAS
PYFEVNRSSGAISLRMDSHSTPVSRSKRELRLIALDVTAHSPLETSRIAVAKVIVDVTHT
SFGLTTDMNTLLISVVAVSLGTIAILITIAVALFFVRLRRHKKKQQKHRQTPVSDTMLHK
LEESKIAANEMIYHQTLPGYAADRSNNGGPYTRGGSLDPSHSSGRGSAEAAEDDEIRMIN
EHPRVSSISSSMQERISARGPDSGIQQDADQLSDVSCEPSIDWFRGKKMGSLNSTLLAGQ
VPVYRDEGGGYDGKPSVDGSLTAIVASDEELRGSYNWDYLLNWCPQFQPLANVFTEIARL
KDETAPPHPRRSFHHKPKPESRIDPPPLITSVAHPGAKTVPPKPAAGRTFPHLGSFRRSP
LSSDGSISSVAMSPSFSPSLSPLAARSPAVTP
Download sequence
Identical sequences H3DFS6
99883.ENSTNIP00000019370 ENSTNIP00000019370 ENSTNIP00000019370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]