SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019373 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019373
Domain Number 1 Region: 377-467
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.09e-20
Family Ankyrin repeat 0.0000258
Further Details:      
 
Domain Number 2 Region: 504-555
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-16
Family SH3-domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019373   Gene: ENSTNIG00000016279   Transcript: ENSTNIT00000019602
Sequence length 568
Comment pep:known_by_projection chromosome:TETRAODON8:16:5065173:5068929:1 gene:ENSTNIG00000016279 transcript:ENSTNIT00000019602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRSPSKWNETDLDLSYERKPHHTYDGRFLSAETEWVRPIVPNSAWRESDLDGPPPATTPK
KFSHSSLPRNARVNVPPEVSSPSHSPYTLQPIVSRISIPPASPLSRQRRPIPLSVIMRLQ
NPYWGAEPTLHPRVGGGSDMAAYFPPAPMPRDFFRQPVFQPQRHPAELRQPALYSDGRAP
ARATLAALSSGDVDAELERLDPAPNLPVIPENPLAQSEQAAAPAPRPLSPTRLQPVVAPE
AQSQEIPNIEELLRIRAEIPRALKRRGSMDPFQPQKTASHYQPNQYKHLIDKLFRKKEHR
PKGDLSSDTNSSSDEEDCAVPPPPAPKKPTTISQEIRPEQPKACESYNSILRWPKQDRKS
SGRRARLSPHVLALDGALVGELETVKKAVQEMVDPSLPNDEGITSLHNAICGGHYNIVDF
LVRAGANVSAPDSHGWTPLHCAASCNDRPLCEFLVRSGAAVMAMTESDCATASQKCDPYA
VGFEDCENFLRGVEEAMGVENSGVLYALWSYPAQAPDELSFKDGDMVTILQKPEGSDWWW
ASLCGREGFVPNNYFGLFPKVKEYRLNL
Download sequence
Identical sequences H3DFS9
ENSTNIP00000019373 ENSTNIP00000019373 99883.ENSTNIP00000019373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]