SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019403 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019403
Domain Number 1 Region: 284-451,492-627
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-56
Family Tandem AAA-ATPase domain 0.00046
Further Details:      
 
Domain Number 2 Region: 57-249
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-36
Family SPRY domain 0.0041
Further Details:      
 
Domain Number 3 Region: 3-68
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000439
Family Tandem AAA-ATPase domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019403   Gene: ENSTNIG00000016309   Transcript: ENSTNIT00000019633
Sequence length 738
Comment pep:known_by_projection chromosome:TETRAODON8:14:6246222:6250869:1 gene:ENSTNIG00000016309 transcript:ENSTNIT00000019633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFSEMGVMPEIAQAVEELDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKDQQEGKKGRASFKTGGAIFNNWQMNPYDRSSAFAIGPDGLCCQSREFKEWH
GCRSTKGVTKGKYYYEVTCHDQGLCRVGWSTSQAALDLGTDKYGFGFGGTGKKSNNKQFD
SYGEEFTMHDTIGCYLDLEKAQISFSKNGNDLGLAFEIPQQLNNQPFFASCVLKNAELRF
NFGGEDFKHTPKSGFLALDKAPEGHTAKSSQTGSAKVSQVKASNGPKALIIEPSKELAEQ
TLNNVKQFKKYVDNPKLRELLVIGGVAAKEQLSALEQGVDIIVATPGRLDDLISTGKLSL
SQVRFLVLDECDGLLSAGYTDFINRIHKQIPQVTSDGKRLQVIVCSATLHSFDVKKLSER
IMHFPTWVDLKGEDSVPETVHHVVVPVNPKTDRLWERLGKNHIRTDEVHAKDNTRPGANS
AEMWSEAIKILKGEYMVRAIKEHKMDQAIIFCRTKIDCDNMEQYFIQQGGGPNSKNHQFS
CVCLHGDRKPIERKNNLECFKRKEVRLLICTDVAARGIDIHGVPYVINVTLPDEKQNYVH
RIGRVGRAERMGLAISLVAMEKEKVWYHVCPRGRGCYNTQLKEDGGCTIWYNEKELLSDI
EEHLKCTITQCEPDIKVPVDEFDGKVSYGQRRALGGGNYKGHVDVLAPTVQELANLEREA
QSSFLHLGYLKNQLFRAF
Download sequence
Identical sequences H3DFV9
99883.ENSTNIP00000019403 ENSTNIP00000019403 ENSTNIP00000019403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]