SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019406 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019406
Domain Number 1 Region: 241-440
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 2.88e-32
Family Sec63 N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 101-203
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-25
Family Chaperone J-domain 0.00092
Further Details:      
 
Domain Number 3 Region: 452-476,632-716
Classification Level Classification E-value
Superfamily E set domains 3.36e-23
Family Sec63 C-terminal domain-like 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019406   Gene: ENSTNIG00000016312   Transcript: ENSTNIT00000019636
Sequence length 733
Comment pep:known_by_projection chromosome:TETRAODON8:14:6094849:6101008:1 gene:ENSTNIG00000016312 transcript:ENSTNIT00000019636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQLRLKSLRRVHGRCLWYR
LRLMKSQHSVVPTLKKAALLFGWAVFLLLAYKVSKLDREYQEYNPYEVLNLDPGASLSEI
KKQYRVLSLKYHPDKGGDEAMFMRIAKAYAALTNEESRQNWETYGNPDGPGATSFGIALP
AWIVDQKNSMLVLLVYGLAFMVILPVVVGTWWYRSIRYSGDQILINTTQLFMHFMYKTPN
MNMKRLAMVLTAAFEFDPRSNKEATIRPTDNIEVPQLIRELGNINVKKKELPFCYPYSLK
ARVLVLSHLARMDVSDELEEDQRFVIRKSPALLQEMINVGCQLTMMANSRGGFHAPRLVT
IENCMKLTQMIVQGLQESKSPLLQLPHFEEEHLRYCLSKKYKVRSLQDLVSLKDSDRRNM
LRTLVEEKYDEVMAVLGSFPHITMDIKLQVLDDEDSNNITAGSIVTVTVTLTRKRMAEVF
EKEQESTPCLPEESTTEETQADSSKTKTKVWQNKSKGAKKTAKSKKKKLTKKKTTPAPAK
SKQANGNVAGAEAATTAAATAKEDEEEASDKGSESDEGEANKDSPSERDEDSDKQSDTEV
DEMAGDDEEEWEALQQSIQRRERALLETKSKVTHPAYSLYFPEEKQEWWWLYIADRRDQS
LVSMPHHVCTLKDTEEVELKFPAPSKTGNYQYSVILRSDSYLGLDQIKPLKLEVHEAKAM
LDNHPQWDIPDTE
Download sequence
Identical sequences H3DFW2
ENSTNIP00000019406 ENSTNIP00000019406 99883.ENSTNIP00000019406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]