SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019416 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019416
Domain Number 1 Region: 95-407
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-97
Family Protein kinases, catalytic subunit 0.0000000493
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019416
Domain Number - Region: 25-62
Classification Level Classification E-value
Superfamily PX domain 0.0017
Family PX domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019416   Gene: ENSTNIG00000016322   Transcript: ENSTNIT00000019646
Sequence length 431
Comment pep:known_by_projection chromosome:TETRAODON8:14:5980830:5983501:-1 gene:ENSTNIG00000016322 transcript:ENSTNIT00000019646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVQTETEQPALTYSKSKGLVTLVTAFMKQRRMGLNDFIQRLATNSYACKHPEVQSILNL
NPPQDAELMNANPSPPPSPSQQINLGPSSNPSAKPNDFHFLKVIGKGSFGKVLLARHRTD
DQFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHYSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYSAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILTD
FGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNISNAARHLLEGLLQKDRTKRLGCTEDFIEIKNHMFFSPINW
DDLNAKKITPPFNPNVTGPNDLRHFDPEFTDEPVPSSIGCSPDSVLITASIKEAAEAFVG
FSYAPSMDSYL
Download sequence
Identical sequences H3DFX2
ENSTNIP00000019416 99883.ENSTNIP00000019416 ENSTNIP00000019416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]