SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019418 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019418
Domain Number 1 Region: 6-102
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 7.38e-28
Family TATA-box binding protein (TBP), C-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 94-179
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.88e-19
Family TATA-box binding protein (TBP), C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019418   Gene: ENSTNIG00000016324   Transcript: ENSTNIT00000019648
Sequence length 185
Comment pep:known_by_projection chromosome:TETRAODON8:14:5971377:5973013:1 gene:ENSTNIG00000016324 transcript:ENSTNIT00000019648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEKEEEELDVTISNVVATFRTGCHLNLYAIACNGHNVIHRPERGTVTMQLRKPRVTANI
WSSGKVICTGATSEQEAKMGARRIARCVQKLNFPVSFSAFKVVNVMVTSAMPFKISLIDF
TKRNRPVTRYEPELHPAAMYTMRHPKATVRVFATGSVTIFGPSVANVTVAIQNIYPLLSA
CRRPA
Download sequence
Identical sequences Q4RR89
ENSTNIP00000019418 ENSTNIP00000019418 99883.ENSTNIP00000019418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]