SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019436 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019436
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily PX domain 3.79e-21
Family PX domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019436   Gene: ENSTNIG00000016341   Transcript: ENSTNIT00000019666
Sequence length 471
Comment pep:known_by_projection chromosome:TETRAODON8:14:5707883:5717475:1 gene:ENSTNIG00000016341 transcript:ENSTNIT00000019666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFSIPETEVCSGENGSSYVAYNIHVNGVLHCRVRYSQLLSLHEQIKKEYGSNVVPAFPP
KKIFTLTPAEVEQRREQLEKYMQAVRQDPLLGSSEMFNSFLRKAQQETQQIPTEEVALDI
SLSNGQKITANILTSDQTEDVLDAVAAKLDLPEDLIGYFSLFLIRELVDGGVTFVRKLQE
FELPYVSISSLQSSDFHILLRKSYWDTAYDGDVMDNRVGLNLLYAQTVSDIERGWILVNK
DQHRQLKSLQEKGSKKEFIHLGQTLKYYGYIKFDPCVTDFPEKGCQVIVSAGNNELNFHV
KLPNEQMKEGSFKVTRMRCWRVTSSQVPLANGTTSTCSSKCEVKLELAFEYLMSKDRLQW
VTITSQQAIMMSICLQSMVDELMVKKSGGSIKKMLRKRHNGSIYRADSQQAVKSPPLLDS
PDTNREQIVKLSTKLSSVSLLGISGSNSANDISGNDFHGNYAFEGIGDDDL
Download sequence
Identical sequences H3DFZ2
ENSTNIP00000019436 99883.ENSTNIP00000019436 ENSTNIP00000019436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]