SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019437 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000019437
Domain Number - Region: 69-125
Classification Level Classification E-value
Superfamily L domain-like 0.000227
Family Internalin LRR domain 0.031
Further Details:      
 
Domain Number - Region: 166-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0402
Family EGF-like domain of nidogen-1 0.062
Further Details:      
 
Domain Number - Region: 149-169
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0806
Family Retrovirus zinc finger-like domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019437   Gene: ENSTNIG00000016342   Transcript: ENSTNIT00000019667
Sequence length 231
Comment pep:known_by_projection chromosome:TETRAODON8:14:5704822:5706549:-1 gene:ENSTNIG00000016342 transcript:ENSTNIT00000019667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGGSQLPATVFVFICNLFFVTSHQPPDLQVCGRCSGTVSNNSQVGQFCFFSLGRIDGR
CCLNNDNTSDPKRITGLDLSNCSLAHIKDLQEASTAVIMDLSLNPIVNISDTTFEGFVSL
NYMILPLDLSCPGGEAAWEKVDVENGSRVCRDQINLCNQTGHLSFTCPGNSLCAPYGPGF
FQCSCTDNFHGYKCVREGEFPTFQVFGPLGAFTVALSLLLWFTQRRQVKRG
Download sequence
Identical sequences H3DFZ3
99883.ENSTNIP00000019437 ENSTNIP00000019437 ENSTNIP00000019437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]