SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019443 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019443
Domain Number 1 Region: 407-689
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-79
Family Protein kinases, catalytic subunit 0.0000000404
Further Details:      
 
Domain Number 2 Region: 856-996
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.05e-55
Family FAT domain of focal adhesion kinase 0.00000891
Further Details:      
 
Domain Number 3 Region: 133-254
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-40
Family Second domain of FERM 0.0000178
Further Details:      
 
Domain Number 4 Region: 31-131
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.86e-32
Family First domain of FERM 0.00054
Further Details:      
 
Domain Number 5 Region: 255-361
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-28
Family Third domain of FERM 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019443   Gene: ENSTNIG00000016347   Transcript: ENSTNIT00000019673
Sequence length 998
Comment pep:known_by_projection chromosome:TETRAODON8:14:5642131:5648374:1 gene:ENSTNIG00000016347 transcript:ENSTNIT00000019673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDTLSWKVPDPRPSGADSSPESHFAVDSGAVKILKVCFCTNNSLGKNFKLVKCDSSWQ
VRAIIRSILISGRLGPNIEHVGSYALLLKHLKSEELHWLHPDLTVEEVEQRYESHHVEAE
WRYDLRIRYVPVNFLEKFNDDRSTLLYFYQQVRNDYMQFHACKVSDGMALQLGCLEIRRF
YKDMNAKGLEKKSNFELLEKEVGLELFFPQQLINSMKSRQLRKLIQQTFQQYATLKEDEC
MVKFFQTLKDFVSYDEEVFPCELVQGWSLAVELVIGGRGIRQRTQKNSAPVFLADFKQIK
KIQCWPQNDGKALVHLDVEGARQQRLSINVAAVSTAENLMDLIDGYCRLERDTDETVIYR
PNKDASARSSLPEIPASFFRCSSDRNSVRHSMGSDIYCEILDEKPKSVEKFGISRSDIVL
GRILGEGFFGEVYEGVYKSDSGTDVSVAVKTCKDCSPDVMEKFMSEAVIMKNLNHKHIVR
LIGIIEENPVWIVMELYQYGELGNYLAKNQSTLTSTTLVLFSLQICKALVYLEGVNMVHR
DIAVRNILVAGPDCVKLGDFGLSRYIEDEEYYKASVTRLPIKWMAPESINFRRFTTASDV
WMFAVCMWEIMSYGQQPFFWLENRDVINQLEQGIRLPKPETCPPALYSLMTRCWAYDPKE
RPSFTELVVKISSAQQLMFLIGFVPHSDVRARSTKFLEPKFNFNEPPPKPSRMKPGRFGN
TLSIGLHIQLNEALCASSPDLASPCYQSPFDSTNTLPVPVRSPRRRSMGEGEVFRVEANS
KEDAQRLWQRERQQLQETLQRQKEQMMEDKKWLAEEERLLDPMGSEENLIPAAPEATAQS
SKSPTAPVKPPRLAAKPAPTAELDRSDDKVYSSVMDLVKVVVQFKNDIAELKPEQYISVV
QSVGMALRVLIQSVDEILPTLHESVRTEIEGTEKLLNNDLAELISKMRLAQQNAITSLKE
ECKKQMLSAAHTLAMDSKNMLDAVDQARVRANIAKPAD
Download sequence
Identical sequences H3DFZ9
ENSTNIP00000002912 99883.ENSTNIP00000019443 ENSTNIP00000019443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]