SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019463 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019463
Domain Number 1 Region: 876-999
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.26e-25
Family Ankyrin repeat 0.000000672
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.06e-23
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 3 Region: 1004-1066
Classification Level Classification E-value
Superfamily SH3-domain 6.83e-17
Family SH3-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019463   Gene: ENSTNIG00000016366   Transcript: ENSTNIT00000019693
Sequence length 1075
Comment pep:known_by_projection chromosome:TETRAODON8:14:5347401:5357509:1 gene:ENSTNIG00000016366 transcript:ENSTNIT00000019693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISQVILTVYLSDGEQAVTEVPITPETTCRDVVEFCKEPGESGCHLAEVWRGNERAIPFEH
MMYEHLQKWGPRKQEVKFFLRHEDSPTESSDQGSQQSQDQTSRRSGNTGEKHNENGVGNQ
RVELTLSELQEMATRQQQQIEAQQQMLVAKEQRLRYLKQQERRQQTTVSESEKLQRLKDR
VESQEKIRAMRGQVDYSKVINGNLSAEIEQVSRLFQEKQAELQSAVLRVEQLSVQLEDLR
RGKINGIQNTLGGQVTGAAAIELRKLYQELQIRNKLNQEQNSKLQQQKELLNKRNMEVTL
MDKRISELRERLYKKKAELNRANGPPSPQPAPSTLGRVAAVGPYIQVPVPGQQEGGYNGP
PEPLKPQTLGVNNQANHGRSKSANDTGWPAVGKNTGLKPPDRRDSGTDTQGKSPPSGSPV
TPGSEKVLDSKMAVSSPAISKPQPPPYGSHLISANSASSLERRKDAPPPLRPLPNPPAPA
WPRVPPTTGSSSQQIQQRISVPPSPTFQPNAPFFPPGVSERLDPPPAVAVRPFIPDRGSR
PQFPRIVPPTMNSSSIYHMYLQQAAPKNQPLKPALKAEINLSSSLVYGKPVLSSSSTPPS
PLPFVQSGGAFPLLQGPASGEDTLDGEGDDQECFQYTEPSAPPPSVENIPRPLSPTKLTP
MVHSPLRYQSDADLEVLRKKLANAPRPLKKRSSITEPEGPNGPNIQKLLYQRFNTLAGGM
EGGGVSGSGGSSGPGTGTPFYQPTNPPVYLGSDSTPDSDNGNLPTETLLPPPGGASPSTD
ANDNEPPAPLPDVLGSPAEAEGAEDDDNNNIVGSSEALVPSPVDEVRTPEESSPVVPRAP
VTDSDVQIVGKRTNLKKPNSDRTGHSFRVKFNPLALLLDASLEGEFDLVQRIIYEVDNPS
TPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGWTPLHCAASCNSVHLCKLLVE
SGAAIFASTISDVETAADKCEEMEEGYIQCSQFLYGVQEKLGVMNKGTVYTLWEYKAQNP
DELSFSEGDAVTILRRQDDSETEWWWARLEDKEGYVPRNLLGLYPRIKPRQRSLA
Download sequence
Identical sequences H3DG19
ENSTNIP00000019463 ENSTNIP00000019463 99883.ENSTNIP00000019463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]