SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019472 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019472
Domain Number 1 Region: 229-359
Classification Level Classification E-value
Superfamily PX domain 3.79e-27
Family PX domain 0.0017
Further Details:      
 
Domain Number 2 Region: 4-65
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000368
Family SH3-domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019472
Domain Number - Region: 389-589
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0262
Family BAR domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019472   Gene: ENSTNIG00000016375   Transcript: ENSTNIT00000019702
Sequence length 592
Comment pep:known_by_projection chromosome:TETRAODON8:14:5261713:5269016:1 gene:ENSTNIG00000016375 transcript:ENSTNIT00000019702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASVKGQVLYDFTAEPGNNELTVKEGETVTITNQNVGGGWIEAQNSRGVVGLVPEDYIEEV
RPAAVKDIFYCVSSITEKNGVCPPSLLSSAPDITDSLAHFSQTSNGSDPWSAWNSDPAGG
SSDNWASNPEGTQTGTGAGDPWSSASHGHPQAYQGPGRADFDEWDDEWDDAKSTGGYGES
ESGEGGAIQRPGAHAPSMKISLNKFPGFSKSGPELYLLCKQFTKGKERLPIYIGEVGPVW
LYPETQLDCMVADPKKGSKMYGLKSYIEYQITPSNTNRPVNHRYKHFDWLYERLLDKFGS
AIPIPSLPDKQVTGRFEEEFIKMRMERLQGWMTRMCRHPVVSSSEVFQTFLTYKDEKDWK
TGKRKAEKDETVGVMIFSTIEAEAPDLSLHEVEQKCEQFSRFTKAMDDGVKEILTVGHEH
WKRCTGPLPKEYQRIGKAFQNLSTVFTSSGYQGESTLTDAMTAAGQTYEEIAQLVAEQPK
KDLHFLMETNNEYKGLLGCFPDTIGVHKAAIDKVKEGDKLVAAGKITSQDKVTMAKRAST
MSYSLQAEMNHFHNNRIYDYNRVMQQYLEEQVKFYETIAEKLRNAHRQFVTL
Download sequence
Identical sequences H3DG28
99883.ENSTNIP00000019472 ENSTNIP00000019472 ENSTNIP00000003435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]