SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019474 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019474
Domain Number 1 Region: 361-429,892-1061
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.2e-40
Family Protein kinases, catalytic subunit 0.0003
Further Details:      
 
Domain Number 2 Region: 8-126
Classification Level Classification E-value
Superfamily PX domain 4.84e-24
Family PX domain 0.0021
Further Details:      
 
Domain Number 3 Region: 251-331
Classification Level Classification E-value
Superfamily MIT domain 5.23e-22
Family MIT domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019474   Gene: ENSTNIG00000016377   Transcript: ENSTNIT00000019704
Sequence length 1064
Comment pep:novel chromosome:TETRAODON8:14:5241660:5255809:-1 gene:ENSTNIG00000016377 transcript:ENSTNIT00000019704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISQRDKGDLARFYTVTDPKKHHKGYTVYKVTARLISRRNPEDVQEITVWKRYSDFRKLH
QNLWQLHKALCSQSELFPPFARAKVFGRFDDSVIEERRQCSEDLLQFSANIPALYNSQHI
QEFFKGGEIHDGSELIGPAEPHADFLADSVSDCSSDGPPSGGDLTSQAVETDSLAGLDDG
MASGRTSPNHPQGEATIPSNSPRLPSLHSPCSPSPAPVSSTPKPEVRPGRSLLFPGSLKK
VGAGASKDVKSDYLDRASELISLAVQKEKEQDFHAAFSCYRNGVDLLLQGVQGEPSPKRR
EAVKKKTAEYLMRAEQIASQHLRSSMGQGSTQTVVIEISSSQSLRSPSEELRAYRVLGII
DKVLLVMDKMTQETFILKGLRKSSDCGRIKRTIVPHSVPHMVQLRKFIVSEDAVFLLLQY
AEGGKLWSHIGKYLRSSSQEGSFDIPFIQKSHTAAIRSPQQAFPPLGADSISSGSAPVAC
PDPASELQKQESCSPSLQKTAPLARPDEESDSGAMSEEEFTNSYLALCNEYEQEKVNADV
LEEQEERSEKEVLSLEVPMGTATTSSRSRSLLSNDSLSSPISSQELGFFPESSKCPLPSP
AVPLTLDQSKHTPMEFFRIDSKDSTGEVNFLDLGEQHISQKSVPIFSTSDLGSDVTEGPP
ELAQEVGLHSGGLWGLDCSDKGSNDSVPVISFKEAAVEDEGHPPDLLVNLPVPSGAVHSS
QEELDTSGVIPGLEAEASPQKFTQPDVLQLLIQPEEEQELPSLHTASATCDTSAASSSIS
SMLEDCSVALGQEKTYQILTCDAARQDVDLPLTDPFNEQHENGTNVNASPGSHPGGGSRS
FSRSTSEAEAHAAQQSSPGLHDEPPRAVCGPRGSEFDKEVSRLFAQLDELSLAASQARIP
EELVKCWAAEMTTALDSLHQEGIVCRDLNPNNILLDHQGHVQLTYFCSWVDVAESCDREA
VSNMYCAPEVGGISEETAACDWWSLGAILFELLTGTSLLRCHPAGIGRHTTLNIPEFVSE
EARSLLEQLLQFNPVERLGAGGAGVDEIKSHPFFVNMDWPNALR
Download sequence
Identical sequences H3DG30
99883.ENSTNIP00000019474 ENSTNIP00000019474 ENSTNIP00000019474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]