SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019477 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019477
Domain Number 1 Region: 913-1201
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.49e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000129
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-27
Family Second domain of FERM 0.00054
Further Details:      
 
Domain Number 3 Region: 215-358
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-22
Family Third domain of FERM 0.01
Further Details:      
 
Domain Number 4 Region: 20-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.59e-18
Family First domain of FERM 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019477   Gene: ENSTNIG00000016380   Transcript: ENSTNIT00000019707
Sequence length 1205
Comment pep:known_by_projection chromosome:TETRAODON8:14:5140054:5154783:1 gene:ENSTNIG00000016380 transcript:ENSTNIT00000019707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFRLKLRRTRRYNVLSKNYFVTRIRLLDGNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFNGKTQAPAHRWVELEKPLKKQLDKFGNEPLLFFGVMFYVPNVSQLEQEATRYQY
YLQVKKEVLDGRLHCAVEQGIRLAGLAVQADFGDFTQFMSQDFLREYVLFPVNWPTGDEV
LEEWTKKVAEEHKSHCRMQAAEAELLYIKEVEKLDGFGQETFPAKDNYTNDIFIGVSFIG
VFVKHRNGRSIMLHKWKDIGTVAHNKSAITVEITSRDDTIIFHMEDMEMAKYIARLFTTR
HKFYKQNKICAEPTHSPAPIRRRPTWTHRISLPRPQSCNFQSMHSQYGEHYQDTQSSQDS
IFHDDPYYKSETSLDRCPVDFPFRNGTVPNGSMYSSPSLSSLNHSQTFVPPSPMSSNLSI
PGSELMRPDYIPSHRHSAIIAPSYRPTPEYDAVMRQKRRMLPAHHDLHSQSLRSLNISNS
CAYRQPEALVYSQPEMRDRGPYHGHGPSPGQYTPQVQGGPANSPGPCHAPSVNGGVEGAG
SSISHTVSTPELANNKQQGANLGNYAATANMLRNHMSRPPPPYPSSHFRPATSTPDLASH
RHRCISGSSPELVTRMVQLSVKTFQPDSSAVVHQSLQEVSEPLTVAAKHRSTLGKRHSME
VISSMRGGGGGVEGLMMKSINGPLHRRNTLREHMAAPNPPEAPVAAPGPSGPYQHQKTLS
NATMLIHSSESEEEDEEEEERPELDVQIPGLNEDISISAQLQAALAKLPNKPPPDYPGPP
KPQNNAQIRTHIHSHKHAHHLNHGRGGSGTLTRGDQSGVNGSVLGPSISEPDLTSVKERV
RKEPVKERPVSEMFSLEDSIVEREIAQRTLERQKMSVDSLKRPLMMAALNGLYVARMPVP
ESPAEDGTKATDERCKTLELKLEEERVFTEYERVPKKSVDCVLTTATLPENVERNRFRDV
VPYEENRVELVPNKENNTGYINASHIKVMIRGEEWHYIATQGPLANTCADFWQMVWEQGV
NVIAMVTAEEEGGRSKSHRYWPKLGSKHNSATHGKFKVTTKFRTDSGCYATTGLKVKHLL
SGQERTVWHLQYTDWPEQGCPEYVQGFLSYLEEIQSVRRHTNSMLDTSKSLNPPVVVHCS
AGVGRTGVVILTELMISCLEHNEPVEVPTMLSELRQQRMLMVQTISQYKFVYQVLIQFLK
NSRLI
Download sequence
Identical sequences H3DG33
ENSTNIP00000019477 99883.ENSTNIP00000019477 ENSTNIP00000019477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]