SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019502 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019502
Domain Number 1 Region: 214-352
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-43
Family Third domain of FERM 0.000000502
Further Details:      
 
Domain Number 2 Region: 104-213
Classification Level Classification E-value
Superfamily Second domain of FERM 1.01e-35
Family Second domain of FERM 0.00000215
Further Details:      
 
Domain Number 3 Region: 510-597
Classification Level Classification E-value
Superfamily Moesin tail domain 3.27e-32
Family Moesin tail domain 0.0000241
Further Details:      
 
Domain Number 4 Region: 20-102
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-24
Family First domain of FERM 0.0000189
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019502
Domain Number - Region: 485-492
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019502   Gene: ENSTNIG00000016405   Transcript: ENSTNIT00000019732
Sequence length 597
Comment pep:known_by_projection chromosome:TETRAODON8:14:4811680:4821809:1 gene:ENSTNIG00000016405 transcript:ENSTNIT00000019732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPLPPRPAFEPLFTLAFPQINVHVTTMDAELEFAIQPSTLGKQLMEQVVKTIGLREIWYF
GLQYTDNKGYSTWLRLDKKVTSQNVKKENPLQFKFRAKFFPEDVSEELIQSITQRLFFLQ
VKESILSDEVYCPPETAVLLASYSVQAKFGDYNKGLHRPGYLVSERLLPHRVMEQHKLSR
DQWEERIQVWHEEHGGTIKEDAMLEYLKIAQDLEMYGVNYFEIKNKKGSTLWLGVDALGL
NIYEKEDKLTPKIGFPWSEIRNISFNDKKFIIKPIDKKSPDFVFYAPRLRINKRILQLCM
GNHDLYMRRRKPDTIEVQQMKAQALEEKQLKQKERDRLEKERKMRESIEREKEQIEQEKK
ELMLKLYQFKEQNKKAEQELKDQVQRAAMLDEERRSAEMKAASLASERQSALLAKEELAR
LAESQQKSKEQLSAELAEYMSKIALLEDDRKRQEHNVNMWQNKAKEAEENLQKTQDELNM
VMMAPPPPPPPPMYDHLYDNSDNEESNSTHSADLHIGDINDHRNEEDRLTEAEKNERVQK
QLKTLTQELAQARDESKNTQNDLLHSENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences H3DG58
99883.ENSTNIP00000019502 ENSTNIP00000019502 ENSTNIP00000019502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]