SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019503 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019503
Domain Number 1 Region: 87-161
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000248
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019503
Domain Number - Region: 142-314
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0968
Family Glycerol-3-phosphate transporter 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019503   Gene: ENSTNIG00000016406   Transcript: ENSTNIT00000019733
Sequence length 338
Comment pep:novel chromosome:TETRAODON8:14:4791729:4794326:-1 gene:ENSTNIG00000016406 transcript:ENSTNIT00000019733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANENVSVVFKVYCLTVMTLVAAAYTVALRYTRTIPSGDLYFSTTAVCITEVVKLILSLG
MLIKETGSPARLKNALVEHVFCSPKELLKLSVPSLVYAIQNNMAFLALSNLDAAVYQVTY
QLKIPCTALCTVLMLNRSLGRLQWFSVFMLCGGVILVQWKPAEATKVQIEQNPLVGFTAI
AVAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYISGIVVTLMGVYVNDGDKVAEKGFFFG
YTSWVCLVVFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVASVVLFGLQITLSFAS
GAILVCVSIYLYGLPKQDMSRLRRQDTTHESREKLITV
Download sequence
Identical sequences Q4RQX5
ENSTNIP00000019503 ENSTNIP00000019503 99883.ENSTNIP00000019503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]