SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019514 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019514
Domain Number 1 Region: 2798-2973
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.59e-33
Family Laminin G-like module 0.00000162
Further Details:      
 
Domain Number 2 Region: 2614-2769
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.1e-31
Family Laminin G-like module 0.0000049
Further Details:      
 
Domain Number 3 Region: 2014-2191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-28
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 2373-2564
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-24
Family Laminin G-like module 0.0064
Further Details:      
 
Domain Number 5 Region: 2240-2376
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.02e-20
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 6 Region: 749-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 7 Region: 1303-1354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 8 Region: 699-751
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000173
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 9 Region: 1364-1414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000257
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 10 Region: 802-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 11 Region: 851-900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 12 Region: 898-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 13 Region: 944-992
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 14 Region: 1412-1450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019514
Domain Number - Region: 59-142
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000368
Family APC10-like 0.071
Further Details:      
 
Domain Number - Region: 990-1047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family Laminin-type module 0.015
Further Details:      
 
Domain Number - Region: 1251-1280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 606-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00781
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019514   Gene: ENSTNIG00000016417   Transcript: ENSTNIT00000019744
Sequence length 2981
Comment pep:known_by_projection chromosome:TETRAODON8:14:4577507:4635716:1 gene:ENSTNIG00000016417 transcript:ENSTNIT00000019744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPAVLNLASMAEVSANATCGSLGPEMYCKLVEHVPGQPVRNPQCRICNQRSVKPFEKH
PIEYAIDGTNRWWQSPSIKNGMEYHYVTITLDLKQVFQIAYVIVKAANSPRPGNWILERS
IDGMTFEPWQYYAITDTECLTRFNITPRTFRGIRHSGAEQNVSKDGKQTKLVHTHPMIHH
LLLTNNVVSLKPVSQLIRIVIRLEVPRADNHQQKSGSHRRQQDADIGSLYARSVLSGLVH
FVQMCVCVSFLACDRHAKQFQIVFLNEPMGEVWPTLCPTEQTNRNNRLFEGKATEQCGVH
VSWLCANAAEIFRHIHTLATSAYPHTTVLGGFFDQIVTEIDRQRGHGRRRSRCQQKAILK
TTIISFPHTVNHLLPFSLSFFQPLSHDFLFFIFRCLLTCTLSDPKDDSCVSFTILWELNV
QYCLCLFLCGFVGCHSLSFVPGQVKRNEKISELKIELNGKTNCKAVFKSYLLYFMVTKET
TFIQNLQLFFLFVTVSILIPISSLSSIRMSAKTAANYLMTPNSLLLFLFNSSSVEYRCFV
KGLIESPISTSLIRKITRRDFLTVLANLTGVMVRASYSTEPSAVYRLHSFAMQIANPFAQ
ENHRASAVEICSCPTGYAGTSCEACIAGFRRVNGNLYNGVCPCNCHGHASQCHEVTGHCL
AQTGTVTGRHGCTSVCFLAPEKESDMEHNWHKCPSSIQSRNFSPTCHLSEGGELLCDQCW
PGYTGPRRERCSNGYYGQPTVPGGSCQPCHCHGNLDLAVPDSCDPVTGQCLRCRQGYSGT
DCESCADGYYGDALTAKNCKPCQCHANGSISEVCSKETGQCRCKENVIGRKCDNCMSQTH
GLNTRGVCVPCHCNSFGSKSFDCDERGQCRCQPGVTGPKCDRCARGFFNFQEGGCTPCEC
SHVGNNCDANTGQCICPPNTIGERCDRCAPNHWGHDIINGCKECGCSVVGSMTQQCNINT
GCCSCHDTYRGEKCDECQIGFRDFPQCTQCECHFSGSDSQTCDPERKVCACADQTGKCVC
KTNVAGHNCDTCKPNTFGLSVKNPFGCSRCYCYGLTQSCSEAQGLIRMWLTLKPDQTVLP
LVDRSNTVETRRGVSFQHPEILVHADLVEPALTEPYYWKLPGQFRGSMITAYGGQLKYAV
YYEARDETGPSSYEPQLIIKGGPNHNILMTRHVQGLQIGQLTRHEIDMTEHEWKFADGQS
MTREDFMDILFYVDYILIRASHGNLMRHSRYTKISLTVAEEGRPSRDSERAHQVEECDCP
IGYSGLSCEECAAGFYRLRAGWLASAPPSRLPTAAGMGGCVQCQCSGHSSTCDPETSICQ
NCQDNTEGDHCERCAPGFYGVVRGFHEDCKPCACPLTNPENNKSFSPTCVEEGLDAYRCL
ACPEGYEGKHCERCATGYRGNPQTPGGRCEECKCSLWGAWPGPCDPVTGQCRCRVGATGQ
SCDQCMERHVCGPTGIISCDDECSGLLISDMDRLYRIITDVTLTTPLPPPYKLLYRFENM
TEELKRISLRTLVLKIGAKDEIEGVLNQAHITCEQATKVSADGEQVEDDAARIHKRAEEL
EQFVRDTLLRATDLQLKAAEVNKTLSRNDGSPDKSLKVMKEDIQAMLAEMRKRQLAGQKS
IAEFCISLAEELYQKVKRLFGDPHQSTEDLKAEIKEKLADHGGKLQEAQDLLHSARGNIR
QAGSLAEQNQANLAALEKKRFAVSKVKEEAKGILEQGEHLLEEANQLSDNINKEVEELEE
MEKELGPLGDRLEVKVSHLTDGLGNGRLANHVLEAEDHAKQLNESAAILDRFLVFIRKVG
IIHISYAVHVSLLCWTDTAAKLTATKAVAADANTTAIDVLERLGELNLHLHRLQRNYSEL
EDTVNAANQMIQDPEKNTLKLNNCTCCKLNIEMALSLTQYNTVNIVSAISFYILIVVKEE
CSLKALLIFATLSSIAVINQFCSLSLLPHSSLHTVHAAGAKVKDLEDETDRLLEKLQPIR
KLQDNLRRNISQIKELINQARKQANSIKVSVSSGGDCLRSYRPDIRKGRYNTITLHVKTT
TPDNLLFYLGSAKFVDFLALEMRKGKINFLWDVGSGVGRVEYPHHTIHDGNWHRIEASRN
GLNGTVSVYPLEGPMAGMMPTPVSANSPSAYTILDVDQKAYLFVGGIFGKVKKADVVRTS
TFTGCMGETFMDGKPIGLWNYRERQGDCKGCVISPQRSDGEGTVQLDGEGYATVGRPTSN
YFILNNRFDSVNTAVLSELGWKDFMSLELSEGKVRVNFDLGSGVGSATSANRHNDGRWKS
LTMSRNKKQATVTLVDIDSGAEEKIMVSSQGSAAGLNLKENQRIYFGGLPSIGNYRPEIT
LKRYAGCLREIEVSRTPYNLLSSSDYTGVTKGCNVENLYTVSFSKPGYVELRGFLLTVGT
EISLSFSTLEDTGTILLAVGGTLPVEQQSERHVPYLSVMLNKGNLEVLMFTGSHSPRRVL
RRLDQGVLNDGREHSLRIERLPGRLSFAVQVDEEAKREAALPNDQSVNLHRLFLGGIPAE
VEQTSNRVNVPFQGCIWNLMINAVLSDFSQPVSFENAEIGQCPNLAPPPPPPLLPDEEDE
SRKDKPEVKPLDPSPVSPPDLCASAVAPAVLEDAYQFGLTRNTHMSFAFDDVKVREKLIL
EFELRAKEESGLLLYMARINHADFVSIQIKDGQACLGYDLGHGNISGCVPYSINDGNWHK
IRVSRNKQRAVLLVDGRYSKQMISPNQADLLDVVGMLYIGGLPQNYTTKRIGPILHSING
CIRNLRVMGGPSIPEDFNLNMATPTSRHMVGSCFDATEMGTFFDGTGFLKAVSSYRVGLD
VSIAFQFRTSRTNGVIVAISNQARDGLGIEIFNGKLLFHVDNGAGRVTAEHVPSGEGFCD
GSWHTVVARKLRHRLELVVDGEQSQAESPNARSNTCDTDDPIYVGGYPAGVHQAALSTST
SFRGCLKNLKITKASKTMDVHFSKALEIRGVQPLSCPAAAA
Download sequence
Identical sequences H3DG70
99883.ENSTNIP00000019514 ENSTNIP00000019514 ENSTNIP00000019514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]