SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019525 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019525
Domain Number 1 Region: 256-365
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.2e-18
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019525   Gene: ENSTNIG00000016427   Transcript: ENSTNIT00000019755
Sequence length 494
Comment pep:known_by_projection chromosome:TETRAODON8:2:16009309:16011785:-1 gene:ENSTNIG00000016427 transcript:ENSTNIT00000019755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMASKCTEQAVHEFLMERGGRVQQMELIEHFASVCGRRDQAKEELDGEALKRVVESVAF
VKVEDGVKFVCLDREGSVGSVISLAGRLDNDKRSTAGDQPAASPPDNKPATESPAASGAG
GEVKLRERRRRESAPVIGVLDPDLAHPSGAHSQQVRGARRISKGSQRAMLVSCLSEDSTL
EGPDPVGDINTPKGSRRNFIELMMSSSPQVRRSLISRGSRVRDSVKGDGDSTSLLSSATD
EDCASVTLDPLEHEWMLCASDGLWDSLQPLLAVEPALVTKRDFVTGFTCLHWAAKQGKAE
LLSQLLAFAKENAIPVNLNVRSSAGYTPLHLAAMHGHTQVVRVLLSDWEADPEARDYSGR
RAIQYLPPPLAANLQEEGVVISPGSESDRESVNGGSGAVSGGGRGWRFPRVLPGSLNPLR
LLNPPAEDAASGKRTKGGIQRKSSLSRLNARLHRGRHRAQIIHSASFKDAEEVGKAEDLP
SSPLRTRPLSNLFG
Download sequence
Identical sequences H3DG81
ENSTNIP00000019525 99883.ENSTNIP00000019525 ENSTNIP00000019525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]