SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019534 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019534
Domain Number 1 Region: 592-861
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-70
Family Protein kinases, catalytic subunit 0.00000000178
Further Details:      
 
Domain Number 2 Region: 186-378
Classification Level Classification E-value
Superfamily L domain-like 3.97e-47
Family L domain 0.00000304
Further Details:      
 
Domain Number 3 Region: 363-489
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.36e-20
Family Growth factor receptor domain 0.00000503
Further Details:      
 
Domain Number 4 Region: 45-192
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.68e-18
Family Growth factor receptor domain 0.000000429
Further Details:      
 
Domain Number 5 Region: 2-67
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000397
Family L domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019534   Gene: ENSTNIG00000016436   Transcript: ENSTNIT00000019764
Sequence length 1189
Comment pep:known_by_projection chromosome:TETRAODON8:2:15718810:15770965:1 gene:ENSTNIG00000016436 transcript:ENSTNIT00000019764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEILNGGVYVDRNKFLCHADTIHWQDIVKTPRIHPLVVPTNSSITCQKCHRSCNGRCWGP
KVDQCQSLTKTVCAEQCDGRCFGPYISDCCHRECAGGCYGPKDTDCFVTCTNFNDSGACV
TQCPQPFVYNPITFQLEHNPRAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENG
VKMCIPCTDICPKACDGIGTASLHMHQTVDSSNIDKFVNCTKINGNLVFLITGIKGDVYH
NIEALDPEKLNVFRTVREVTGFLNIQSWPDNMTDLSVFSNLATIGGRALYSGISLLVLKQ
QGISSLQLQSLREISAGNVHIEENSQLCYYNTINWTRLFRTSNQKALIRNNQSPEQCSKK
HMVCDPLCSDAGCWGPGPDQCLSCKYFIRGRTCVDRCNLYEGEIREYANGSMCVECDGQC
ELADDDSLTCHGPGPEHCEKCLHFKDGPNCVEKCPDGLQGANSFIFKYAEANNECHPCHA
NCTQGCHEDNMHKDVLPPWAQNNYIQQILKTPLIAAGVIGVLFMVVIIVLSVAVSMRRKN
IKKKRALRRFLETEFFSPLSHFLSSPNKKALAKLYKKIIENVKRLKTALNLYKGIWVPEG
EKVKIPVAVKILNEATGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPH
GCLLDYVHEHKDNIGSQLLLNWCVQIAKGMLYLEERRLVHRDLAARNVLVKSPNHIKITD
FGLARLLDVNEKEYNADGGKMAIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPY
DGISTRDIPDLLEKGERLPQPPISTIDVYMVMVKCWMIDADSRPKFKELAAEFTRMARDP
QRYLVIQGDDCMKLPGPNDSKFFQSLLAEEQLEDLMDAEEYLVPQSFNVPPLAYTPRTRM
DSNKSIFHHHPAVGYISNNQFSYQDPSYSMENMLATLPRGVPGATVSGGCLPTQDLASGG
QMGVGFIRSNQDDPRCNGTLRKQASPRAGDDGSAQRYSADPTGLLSERGAKGDQDGYMAA
ARDRKVADPNYLNSVEENPFVTRRRNDEAHVAMDGASCHTLHIARAAAAPKNQHIHGDDA
YLNEPLYLNTFLNPGHTGHVLHSGTASNTIMKNKKANFDNPEYWQHSLPPKSSLHNPEYL
QDCSTRFFYRQNGRIRPAVAENQEYLSEAAMKAGNVLPPPPYRQRNTVV
Download sequence
Identical sequences H3DG90
ENSTNIP00000019534 ENSTNIP00000019534 99883.ENSTNIP00000019534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]