SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019563 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019563
Domain Number 1 Region: 238-539
Classification Level Classification E-value
Superfamily SPOC domain-like 1.41e-93
Family Ku80 subunit middle domain 0.0000000216
Further Details:      
 
Domain Number 2 Region: 9-236
Classification Level Classification E-value
Superfamily vWA-like 3.25e-45
Family Ku80 subunit N-terminal domain 0.0000012
Further Details:      
 
Domain Number 3 Region: 557-704
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 2.35e-41
Family C-terminal domain of Ku80 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019563   Gene: ENSTNIG00000016464   Transcript: ENSTNIT00000019793
Sequence length 728
Comment pep:known_by_projection chromosome:TETRAODON8:2:15008154:15013739:-1 gene:ENSTNIG00000016464 transcript:ENSTNIT00000019793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFASNNESALMLCMDVGFSMSNSAPGEEPPFELAKKIIQKFVQRQVFAESKDELGLVLFG
TDSTNNLLHQDGQYENISVFRELSVPDFDLLEQIQNQLQPENQQADWMDALVVCMDLLQR
ARTGKKYDRLNIVQLTDLNIQASSDQLDIIIQNLKSSDITLQFFLPFPAEDDEDGGGDGP
RSESGHPGRGKGLSRDQKEGLDMMKHIMLSLDEDDGLDQIYTFRNAIEQLRMFKQIERRP
MAWPCLLTVGSCVSIRIVGYKAVMQEKLKKTWMTVDAQTNQKEVIKRETVYCLDDDNETE
VQVTETIQGFRYGSDIVPFSKVDQEQMKYKHDGKCFAVLGFTKQNLVHRHQFIGNQVIKL
FAAKDDEHAGVALSALIRALRELEMVAIVRYAYDRRSNPQVGAAFPCIKQHYECLMYIQL
PFVEDLRQFSFPSFDNKKVTPTETQLSAVDSLIDSMMLVEEGDDGKPKDMFKVHHIPNPE
FQRLFQCLHHRVVNPGTPLPPIEPWLKAVLGRPDVIGQRCQAPLEELKRVFPLTQVEKKK
NLKTSAEVFGKDSGEPDGKKAKHDEEEEEEDFNLANITEGSITSVGSVDPARDFCFLVKQ
KSIPFGEVCQQLIQRIEQLLSNRNTEYYTKSITGIQAFREQSVKLGNADLYNNYLQSLKG
SITNRQLEVFWDLLVQDGLTLISNDQVKGSAIFNAEANQFLVGVEKKEEVAPPPAEDNED
VDDLLDMM
Download sequence
Identical sequences H3DGB9
ENSTNIP00000019563 99883.ENSTNIP00000019563 ENSTNIP00000019563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]