SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019564 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019564
Domain Number 1 Region: 535-773
Classification Level Classification E-value
Superfamily vWA-like 1.93e-38
Family Integrin A (or I) domain 0.004
Further Details:      
 
Domain Number 2 Region: 793-986
Classification Level Classification E-value
Superfamily vWA-like 2.23e-26
Family Integrin A (or I) domain 0.0055
Further Details:      
 
Domain Number 3 Region: 4-166
Classification Level Classification E-value
Superfamily vWA-like 2.23e-22
Family Integrin A (or I) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019564   Gene: ENSTNIG00000016465   Transcript: ENSTNIT00000019794
Sequence length 986
Comment pep:known_by_projection chromosome:TETRAODON8:2:15001416:15007558:1 gene:ENSTNIG00000016465 transcript:ENSTNIT00000019794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDVVNCPIKVFFTIDTSETIALQESPPGALVESIKQFTRTFVRALSDEEYRGHIQISWSV
GGLNFSQDHWVFSQFTNKQNFIRNLGQVRYKGKGTFTDCAIKNMTYEMTRHDSDTKAVPF
AVVITDGHVTGSPCGGIKAMAEKAREQGIRIFSVAASRKVDELGMRIASPPVELYRDDYL
AVDIVRGRPSIKTDSIDRIIKAMKYQAYLQCYQQKCLETPGIPGPKGAHGPKGIKGERGA
VGAKGVKGKRGDPGIEGPIGRPGPKGSIGLKGDKGETGATGAKGTAGIPGREGIDGQKGK
PGRIGTPGCKGDPGDKGPNGFAGDVGETGAPGEKGTKGDSGYPGKPGPPGPPGDIGQKAE
RGYPGSPGPEGVKGERGPPGSAGAKGERGRRGNAGKQGAPGPNGRKGDKGERGPVGGRGQ
PGDPGPKGAKGEQGLPGPRGQSGEAGNPGANGTVGNPGDAGPRGDPGPTGPKGDGGRPGF
NYPGPRGKTGDRGDPGRKGPRGGRGECGAKGEPGDKGTPGEAGEPGEPGEPGVRGSRGDP
GPDGEPGPVGDPGFTDCDVMTYMRETCGCCDCEKRCGALDIVFVIDSSESVGLTNFTLEK
NFVINTINRLGSMASDPAATTGTRVGVVQFSHNGTFEAVRLDDPNINSMSAFKAAVKRLQ
WIAGGTFTPSALKFAYDNLIRNSKRARAKISVVVITDGRFDPRDDEDLLKYLCDHDNVAV
NAIGVGDMFKKQQDDEILGSIACNRKERVTAMRRYTDLVAEDFIETMETVLCPEPEIVCP
DLPCKSEAHVAPCVERPVDLVFLLDGSERLGQSNLQYVREFVQKVSDRLVLARSRTDRMR
ARMALIEFGKENETHVAFPLTHDQAAISDGIARLPYFDSSSSVGPAIIHTIDKVLGKGPA
RKTRRNVEISFVFITDGFTDSRNLEEAVSAMRGAQVVPTVIATGNDVDEEVLMKLAMGDA
EAIFKAKAVTDLSQPALFERFIQWVC
Download sequence
Identical sequences H3DGC0
99883.ENSTNIP00000019564 ENSTNIP00000019564 ENSTNIP00000019564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]