SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019574 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019574
Domain Number 1 Region: 437-553
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000359
Family Ankyrin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019574
Domain Number - Region: 6-44
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0238
Family variant C2H2 finger 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019574   Gene: ENSTNIG00000016475   Transcript: ENSTNIT00000019804
Sequence length 678
Comment pep:known_by_projection chromosome:TETRAODON8:2:14884303:14888962:-1 gene:ENSTNIG00000016475 transcript:ENSTNIT00000019804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIQAPREVSDKMVCLACRCTFTNREDQMEHYKLDWHRFNLKQKLLGASPVSAEEFEKKTG
AGDLSSISGSESDTEEGADSNHITGTENETLPESGEGSGRPCTKILFQNSAGQYLSVHRC
ILQGKSAQSDGEQDAGSSLKDINKKTSWVILMTGGGHFVGAVFQGKDVLQHKTFHRYTVR
AKRGTAQGLRDSQNRSHAPKSAGAALRRYNEAALVKDIQDLLVSWSEHLQEASAVFIRAP
SYNKGIFFGGRAAPLDKKDPRIRSIPFATRRATFREAQRVHEVLSTIHVYAKDTDVSAIF
SPSKKVWKKTVKHAAQAKTDPDLDKIHKTELPENRFSPCLVAAAEHQLTSEEEGDEIQLE
TLEVTLGTLDLRESEICPARHQRRRRRKKVSKTKAGNAEEDILEATTGNGTEERPSRTNT
GAQKFSLKKGADDSVEYSLRDSLFTACKVGDIDSLHTLLQLPTQRADIHQQSVSHPSAAL
GALLNEPVDSSGFTLLHVATAAAQKATVRLLMEAGADPACRDNKGRTPYIVAPDKDTRNV
FRKYMGDNPDRYDYKKAQVPGALTVEMESKQLEKKKAQKLLRKQRDKEHKEELKKQELEV
EEKKRFASLSDREKRALAAEKRLAKQVAATGVDIINVTRCWSCGESLLGKVPFQYSEYSF
CTPRCVQAHRKANAAPGK
Download sequence
Identical sequences H3DGD0
ENSTNIP00000003152 99883.ENSTNIP00000019574 ENSTNIP00000019574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]