SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019592 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019592
Domain Number 1 Region: 899-1258
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.73e-75
Family Ankyrin repeat 0.0000123
Further Details:      
 
Domain Number 2 Region: 1278-1408
Classification Level Classification E-value
Superfamily TPR-like 2.37e-22
Family Tetratricopeptide repeat (TPR) 0.0017
Further Details:      
 
Domain Number 3 Region: 348-435,546-611
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000152
Family Extended AAA-ATPase domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019592   Gene: ENSTNIG00000016493   Transcript: ENSTNIT00000019822
Sequence length 1835
Comment pep:known_by_projection chromosome:TETRAODON8:2:14386319:14423680:-1 gene:ENSTNIG00000016493 transcript:ENSTNIT00000019822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAHASQSTEDDVFRLGFAKGVSMSLPSSPLLPRQSYMMPLRSSKRSPGPSRKPKYVESPR
IPSDAITSALSGKLASFSESQSPELHTEKQPSSSSPATQELMTRLGFLLGEGIPGTARIP
MDDKNEKKCSAASQGISPCSTLTSSTASPSTDSPCSTLNSTTSRPPLSRTSPCGTITSPS
STLESRDSGIIATITSSSENDDRSGSSLEWSKDGSLRGSSHHGFAHSVRADTCSPVAEED
SSGATTTPADTPSRIDQQPQANASAGAPLPPVHSPEGPVLYPSQASASLMMPRPNSVAVS
KATSSTKLEDLSFLDEQRNTPLRTSIRLPWHNTGGRPPPDSKARFAPYKPVDIMLKPLLF
EVPSITTDSVFVGRDWLFQELEGILKTTDCTQSQGAVVVGSVGYGKTAIISRLVALSCHG
GRMRQIASNSPSASPKSGEGSSTELLLTQPPQPTPPSSAANTLRTSSCPGTPEMQRRREE
AVRRLAAKVVAYHYCQADNTYTCLVPEFVHSIAALLCRAHQLSAYRELLLKEPHLQSMLS
LRSCVQDPMAAFRRGVLEPLVSLRKERKIPEDDHIILIDGLNEAEFHKPDYGDTIASFIT
KIIAKFPSWLKLVVTVRINLLQITSLLPFEKISLDDFSDNKEISNDLNAYIHYRINSSKE
VMSNISLNGKADPVTVGKLSSHLISRSQGSYLYLKLTLDLFERGHLVIKSASYKVVPVSL
AELYQLQCNMKFMTNSAFERSLPILNVALASLHPLTDEQVFQALNAGFIHGELQWDDFQQ
RMELLSCFLIKRRDKTRMFCHPSFREWLVWRADGESTDFLCDPRTGHALLAFMLSRQEGK
LNRQQTMELGHHILKAHIFKGLSKKTGVSSSVLQALWISCSTDGLSAALASLRNLYTPNV
KVSRLLMLAGANVNYRTEVLNNAPVLCVQCHLGHQEIASLLLEFGASVDVVSENGMSPLC
FSAAAGHLGLVMLLCKRGAKVDHTDKSGQSGLVHAALRGHLDIIQFLLQLEWSSEGLQQD
CALKNKALQQAFIAASSMGHTQVVRDLLALNNEHTVQIDSHDTLWGETALTAAAGRGKIE
VCTFLLEQGAVVQQVNRRGVSPLFCAIRQGHWQIAEQLLQHGADINVSDKQGRTLLMVAA
CEGHLSTVDFLLSKGASLTSMDKEGLTPLSWACLKGHKNVVQFLVEKGAVIDHTDKNGRT
PLDLAAFYGDAEIVQYLVERGAVIEHVDYSGMRPLDRAIGCRNTSVVVTLLKKGAKLGNA
AWAMATSKPDILIILLQKLMEEGNLLYKKGKMKEAAQRYQYALRKFPRESFGDDLKAFKD
LRVSLYLNLSRCRRKTNDFGMAEEFASKALELKPKSYEAYYARARAKRSSRQFAAAMADL
HEAAKLCPNNREIRRLLARVEDECKQMQRVQCKGGFAGATAACLQASGGHDSDQEQDEGE
GDASEHSLSSSLHERTNEAGCSQSSFPYSRVPPSEHINSLGHQGPGSPPGPSRPPLHRHP
REHREAPPQQALVLQPTRQAQIVKTNQHMSSVQAGGGPAGGRLPGSKSQYAPSSPVPGRH
MSSMLKPGPGIDISLLSPPADEPVYGNRVPTAKSCENDSHHSSQIPHGSSSKALGQDRLS
AQSAPSLEGVACSGPGPQDKPGEPGKEATCGAAGWPSGGLRVSSSSSSLADGSKLGPDVR
SKLSDKSKHGQPPGPTAEHKPRPFMGITDKTARFQHPLHPQQQGGRGWLNHSSDPLPGEY
ELPYAKAASTYQEQHKPPSAQGAVAMSSLQNGVHAKEFAEKFCQAASCYKESKPALAMTH
AFMDGKAKQPALSRDNSAIHVTSIKPKRSFIESNV
Download sequence
Identical sequences H3DGE8
99883.ENSTNIP00000019592 ENSTNIP00000019592 ENSTNIP00000019592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]