SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019610 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019610
Domain Number 1 Region: 41-217,295-454
Classification Level Classification E-value
Superfamily L domain-like 2.16e-62
Family Ngr ectodomain-like 0.0054
Further Details:      
 
Domain Number 2 Region: 549-690
Classification Level Classification E-value
Superfamily L domain-like 1.63e-36
Family Ngr ectodomain-like 0.00073
Further Details:      
 
Domain Number 3 Region: 487-657,739-878
Classification Level Classification E-value
Superfamily L domain-like 3.4e-33
Family Ngr ectodomain-like 0.00058
Further Details:      
 
Domain Number 4 Region: 1147-1300
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.72e-26
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 5 Region: 1079-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000217
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 919-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 7 Region: 959-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.006
Further Details:      
 
Domain Number 8 Region: 997-1037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000139
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 9 Region: 1298-1336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000041
Family EGF-type module 0.024
Further Details:      
 
Domain Number 10 Region: 1343-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019610
Domain Number - Region: 1390-1426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000287
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1044-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00185
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 1126-1156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0371
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019610   Gene: ENSTNIG00000003631   Transcript: ENSTNIT00000019840
Sequence length 1504
Comment pep:known_by_projection chromosome:TETRAODON8:18:11062842:11076795:1 gene:ENSTNIG00000003631 transcript:ENSTNIT00000019840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGGGSSAAGCLPRVQLAWAAALLLVPWGGGVEACPSPCSCLGATVDCHGRGIHAVPKNIP
RATERLDLNGNNLTVISRTDFAGLRHLRVLHLMENQIVAVERGAFDELKELERLRLNRNR
LGQIPELLFQKNEALTRLDLSENVLQAIPRRTFRGATELKNLQLDKNHISCIEEGAFRAL
RTLEVLTLNNNNISSIPVSSFNHMPKLRTFRLHSNSLRCDCHLALSPWLRQRASLGLYAQ
CSSPPSLRGLNLAELRKSDLACSGEAPPPGPCSLASGSCPPMCTCSNNIVDCRGRGLTAI
PAHLPEAMTEIRLEQNGIKSVPPGAFSSYKKLRRIDLSNNQIAEMAPDAFQGLRALSSLV
LYGNKIAELPAGVFDGLSSLELLLLNANRIHCIRASLFKDLENLALLSLYDNRIQSLAKG
TFGSLRSIQTLHLAQNPFVCDCHVRWLAEFLRANPIETSGARCASPRRLANKRIAQKSSK
FRCSEKSPAYNNPRSSTSSQANRLCPANVVDCDNQRLTLFQPPPDQLPPTPASQRLNNND
LSVLEATGAFKGLSQLKKINLSNNKISEIEDGAFEGAASVVELHLTANHLDAVRGSMFKG
MEGLRMLMLRNNKISCLHNGSFTGLNNVRLLSLYDNQLSTILPGAFDTLPNLSTLNLLAN
PFNCDCRLSWFGAWLRSRRIVTGNPRCQSPAFLREIPLQDVAAPDFRCEDGAAQEEAGCG
LGPQCPSQCTCMDSVVRCSNKHLQALPRGLPRNVTELYLDGNQFTSVPKELATFRFLQLV
DLSNNKISFLSDDSFSNMSQLTTLWRLQTLSAASPLLALSGLRSLQIWLSLHGNDISELT
DRASYSRRAPSLSHSVRAIGANPLYCDCRLLWLSDWVKSGYKEPGIARCAGPGGVEGKLL
LTAPAHSFQCDGPVEPSVRAKCSPCVSSPCQNQGVCKDDHTQLFTCTCKPGFTGKHCETP
VDACVSNPCTNGGVCLSDEQTGGFRCACAFGFHGTFCEVNVDDCQDHGCENGATCVDGVG
NYTCLCAPSYKGLFCEEVDSVCGPGRNPCQHQSTCISTPAGPRILYLCNRIPGWVGPECS
IDYNECVDHRCQNGAECVDHLDGYSCVCPQGFSGQFCEAPPPPASPCQLAQCQNGALCVE
AAGAAACTCAPGFEGQRCEKLVSVNFLERDSYVQLQDVKNWPHANITLQVSTAEDNGVLL
YNGDNEPIAVELHQGHVRVTYDPGDQPATSIYTLEGRGRSQAAAGEAPLYVGGLPEEAVP
AAPDAVNVSGFHGCIRKLYINHELQDFTRSHMGAGVEPGCQACRQSYCAHGTCQPDAAQG
PRCHCHPGWAGPRCDRPATAEGVTVATGVDPCADSRCVQGACVPVDARTYRCDCRDGYEG
ALCHLQRQPASWCGRLPCVHGQCERTEKAERCACEDGFSGQSCDIELPCGGQPVRDHHRL
RRGSALCQTAKPFSWVECRGRCGVATCCAPLRLRRRRLSFQCDDGTTFTQDVEKPVECGC
KECV
Download sequence
Identical sequences H3DGG6
ENSTNIP00000006226 99883.ENSTNIP00000019610 ENSTNIP00000019610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]