SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019623 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019623
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily vWA-like 7.7e-36
Family Integrin A (or I) domain 0.00000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019623   Gene: ENSTNIG00000016523   Transcript: ENSTNIT00000019853
Sequence length 534
Comment pep:known_by_projection chromosome:TETRAODON8:17:4936696:4949024:1 gene:ENSTNIG00000016523 transcript:ENSTNIT00000019853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCHGAFDLYFVLDKSGSVKHHWTEIYSFVKQLAEKFISPMLRMSFIVFSTRGNIIMKLTE
DREAIKGGLMALKNVIPGGDTLMNLGLEMANMQIYQERYGTASVIIALTDGELNEWQFDL
AQQEAQRARSMGAIVYCVGVKDFNQTQLATIADTVEHVFPVWGGFQALRGIIDSIIKKSC
IEILAAEPSSVCAGESFEVVVKGNGFLHARNIDQVLCSFKLNNTLSVDERPARIEDTFLL
CPAPVVEEPGRVIYLQVSMNEGLSYITSSVHITTTECFDGTIVLISLLVVFLLLALLLMW
WFWPLCCTVVIKEPPPPPPPEPESDEDDGMPKKKWPTVDASYYGGRGVGGIKRMEVRWGE
KGSTEEGAKLDKPKNAVVKMPDQEFEPYEPKPRKPPRHRPQQRRWYTPIKGKLDAIWALF
RRGYDQVSLMRPHPGDQGRCINFQRVKDGEPTRTNQAPPRTSHSSSLPPPPPAAVERPLI
SNSVPRTKPPSRGPRTEPPARAPPSVATPAPGPPPARAPPGPRAPPPSRPPPKL
Download sequence
Identical sequences H3DGH9
ENSTNIP00000019623 99883.ENSTNIP00000019623 ENSTNIP00000019623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]