SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019626 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019626
Domain Number 1 Region: 422-530
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-29
Family Second domain of FERM 0.00029
Further Details:      
 
Domain Number 2 Region: 913-1015
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-27
Family PDZ domain 0.00099
Further Details:      
 
Domain Number 3 Region: 531-646
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-26
Family Third domain of FERM 0.0046
Further Details:      
 
Domain Number 4 Region: 733-839
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-25
Family PDZ domain 0.014
Further Details:      
 
Domain Number 5 Region: 1046-1153
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-20
Family Interleukin 16 0.057
Further Details:      
 
Domain Number 6 Region: 334-422
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.33e-18
Family First domain of FERM 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019626
Domain Number - Region: 16-160
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000175
Family Protein kinases, catalytic subunit 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019626   Gene: ENSTNIG00000016526   Transcript: ENSTNIT00000019856
Sequence length 1154
Comment pep:known_by_projection chromosome:TETRAODON8:17:4892783:4901065:1 gene:ENSTNIG00000016526 transcript:ENSTNIT00000019856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSGAWNECRMSSTFVTLAEVLEARGGPLLEEEVWSLLLSSAEALVDVSYKGLNSMSTIIS
PASLLLSATGILAFKNCGLTDEVSTFTAPEMLQGRASASRPATERMLVYSLGMTLYWAVD
FQLPQNQPVQLSDHLNSVLLSMCEDMAHRRLNLNSILEACESQHKASILPSPTKVIKQLA
EEVFREPVDQESQRDSNVPLSGRSQVIRERLHGVRTSVQQDYNLIPKLKHPAGLTPTQTS
HIPVVHRLQESSTSVIRHLQTPPQVKGSHLQTSVKGALRGGDTPQTLTPSQRLLPQPESE
TLGPEFIRMSDEPQIVLELPGSIVSRKGRSCLSQREVTVVLPNGQYVVVRCDIKSRARDV
FDMVVAHANLVEHFYFSLAFLDDDEYFFLDHETKISKVAPDSWKKGQMSCFLVFLRVKFF
VDDVSFVLHNLTRHQYYLQLRKDILEDRLYCNEETGLYLVALALQIEFGDYIPELYGKNY
YQPEHYVSKRMLEKLALPTIKEELPRLHASHAHMLPEEAETEYLKIAQQLPEYGVMFHRV
GREKRPVVGELVLGVCAKGIIVYEMKNHIRTVTRRFLWRETDSISTGRRKLIIECGGPSG
KKHGFVTESSKIAQYLLNLCSAQHKFHSEMSSRQLNHTVIPDEKYMAVYRDHSSNLKRMS
CSEGMLNHIGLTPAQPDSVSKSCDDLTAEGDEEGDEQGAQQGARSRRQLVKQSCSCCSTL
EPIPRMMSCVSLQKQDSDTSSIRGDSPEREIVCVTLKKDQKLGFGFVIVGEDNTGKLDLG
IFIASIVPDGPADRDGRIKPGGRLISLNKISLEGVTFTDAAAILQSSPDEVELIVSQPKQ
SLKDSRGCLSQSTLGLALERGFGSQTTLNADYRPVVEELEEAISLSSMATSKQNKRLHIP
VVRIHDAQDICSRSPSIISLKTAERFVLELKKSSGSLGISVAGGMNTTVRYGGIYIKSLV
PGGAAEQDGRIQIGDRLLEVDGTNLKGVTHQQAVECLKKTGEVVVTLLLEREPTIMLESR
PDSPCPLLAHSPSHVQPPRTEVSIETTLSDRAKDYSFVTDDNTQEVVLKKSLSGLGFSFN
ISHLRSGLDNGSVVRIKRLFPGQPAMESGLLREGDVILSVNSEPLKDLSYQRVLFMLRGA
PPEVRLLICRPGPG
Download sequence
Identical sequences H3DGI2
99883.ENSTNIP00000019626 ENSTNIP00000019626 ENSTNIP00000019626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]