SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019629 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019629
Domain Number 1 Region: 20-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-46
Family Ankyrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019629   Gene: ENSTNIG00000016529   Transcript: ENSTNIT00000019859
Sequence length 546
Comment pep:known_by_projection chromosome:TETRAODON8:17:4872087:4875261:1 gene:ENSTNIG00000016529 transcript:ENSTNIT00000019859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLPVCSASGGDIFDSIQRGNVEECLQFIQNDRSVLKQKGWGGFTPLHYAALHGNRALV
ILFLSNGADTNLACDAGQTAFHFACRQGNIYIIHQMMQHGADLHIRDLQGKTAMHHAVTG
GSIVTVHYLWETGMFHFSDTDMYHVTPLHLAASTSNTEMVRYLLREERCAVEAADHQGAT
ALHVAAERGSAEVCWALLQRGWRALHHRNHSGLTPLDLSRQGKTFRHQQLTKLLNRYINE
PSDHKPRESNVLYYWTLFFPTLGGAAVLLIAAMLGGYGGMICCLLFPWLARSIFSQYHRL
TTYQRLPNPIYLGTLIAGLFHSLLCFYGKIVSVVHSLLVVGLLCKVLIHNPGTLERANAD
PRFSCIADLVAQNQSPHKFCPCCELFLPDCTKHCKLCDRCIEDYDHHCLFLNRCIGRGNH
RLFLVFILSMVIAHLLFLAMAVAYLLERIPPGGRSLSRWLTLLGGEFWVVVLMSINSLTL
LWEVWLLREQFEAVATGTTTYFRQGGSSAGRRSLGQRWGTVLKFLVEGRRRISGVHVGEG
KTAIDI
Download sequence
Identical sequences H3DGI5
99883.ENSTNIP00000019629 ENSTNIP00000019629 ENSTNIP00000019629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]