SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019654 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019654
Domain Number 1 Region: 602-687
Classification Level Classification E-value
Superfamily BRCT domain 6.15e-21
Family BRCT domain 0.011
Further Details:      
 
Domain Number 2 Region: 707-786
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000785
Family BRCT domain 0.012
Further Details:      
 
Domain Number 3 Region: 14-82
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000034
Family DNA ligase 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019654   Gene: ENSTNIG00000016554   Transcript: ENSTNIT00000019884
Sequence length 787
Comment pep:known_by_projection chromosome:TETRAODON8:17:4602102:4618063:-1 gene:ENSTNIG00000016554 transcript:ENSTNIT00000019884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICADVVAYVDVWSSDKTANCSKPFIKQLQEMGAQVSKTFTKQVTHVVFKNGPATWRKAKK
REVKLVSVLWVGRCXENGRWYDLIMSECLNLNVFKYSVVLTSHRCMQPKDSPERTPENDR
RMKRKLDKMMKDLVPQQPIVTDVSPIIIDEESGIVYSPGLKRSDYMAQRLKDMKEKRENL
SPTASQMIESSSPVGMKPSLGSTPTHWNLQCKNVVWSCYSSKSDLVGNAENTPDKKPAEK
QTQKSRGLSESPRKEDTSDSHRSFIEETRQSQRRSSRPSRGSPINRKTKIATAKYLTETE
SHIIPENVNSPNISQKGKKKETTKFIRSPVISHSVNSSSCLSSPVGPDDAAAKCSKETFT
PLGKKKQRTSRPSRLSASSLAQSAILLSSTQSVASNSAGGDVFEDYFSPAHNHRETKRHL
LPDLPVEGSSHMPFELDSILNKRKRRRCESIGSVAKIKKKKPEINDKGKNQKNDAEIEHQ
SPSCHDVEASLPRTMSNATHSAKKGRESILPTTTNTDAAKQRRASTSSMSELIETNATSE
LNTLFMLPPHLYLNVDGGSVGTVAAGVAENLSEDEDDHKQVSLRRPKMANKKLGVAKKST
RTLVMTSMPTEKQNIVVQVVTTLGGFSIVEQVCESTTHVVSWGHRRTLNILLGIARGCWI
VSFDWILWCLEQRQWIPEEPYELSDHFPAAQICRLQRHLSAGEHQQDLFQNQPPMFVSQH
SQPPTQNLVELIQLCGGTVCKTVRQAGICIGKYSGRIPQGSRVLSEQWVLDSITCLKQLS
YDDYILE
Download sequence
Identical sequences H3DGL0
99883.ENSTNIP00000019654 ENSTNIP00000019654 ENSTNIP00000019654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]