SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019674 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000019674
Domain Number - Region: 34-137
Classification Level Classification E-value
Superfamily Prefoldin 0.0889
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019674   Gene: ENSTNIG00000016574   Transcript: ENSTNIT00000019904
Sequence length 206
Comment pep:known_by_projection chromosome:TETRAODON8:17:4373216:4374656:-1 gene:ENSTNIG00000016574 transcript:ENSTNIT00000019904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAKIQAKMNEAFNTKFSRTLSMADRSGQLLESLDQLEMRVEALRDAASALEQERESIM
EMIQSIQTGQEMRNICPGEREELELTANRLMGRTLAVEVSVGTVRNLQQEEALNKATSII
DEVVQKLLDNMEGGRQRLLALHAACLTEAPTVPVPIDQRFQAVVISCALEDQKKIKRRLE
TLLRNVENAEKNIKLMDHQKLANSCQ
Download sequence
Identical sequences H3DGN0
ENSTNIP00000019674 99883.ENSTNIP00000019674 ENSTNIP00000019674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]