SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019683 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019683
Domain Number 1 Region: 74-242
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-29
Family Laminin G-like module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019683   Gene: ENSTNIG00000016582   Transcript: ENSTNIT00000019913
Sequence length 1135
Comment pep:known_by_projection chromosome:TETRAODON8:17:3991623:4055158:-1 gene:ENSTNIG00000016582 transcript:ENSTNIT00000019913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MICFLSWTALLWTVNSIMSTLGMAVSEQMDESCPPLDVEKHRFSTTLDHPLEVTGRFLPE
YFLLRKGTVSEDLPSFRLGSSPLIKPTRLVFPNGPPVEYSIVTIMRVRRTTKKDRWYLWQ
IFDQSGNSQLSIVVDGGQKTMEFSFQGLLRNLLRYTFRSRDLHALFDRLWHKLSISVQSN
IVSIYMDCKLIERRLIDERGGVDPGGRTVIATRVENGRPVDIEMKQFLIYCDPYVAEMEN
CCELREPKCEASKTFNGTTPPTVTAPLPQMLSQPELPSLDRCQCSTEKGDAGLSGGVGPA
GPKGDKGETGEVGGRGNPGQKGELGSEGQKGIDGEKGEKFLCTKLQLNLNSLNGENGLKG
DPGPAGPVGSMGPKGSKGDAGLPGTPGLPTSLRSMWGGPQLLPYQKKHEGRRGKTGEPGP
RGPPVSRPTHSTTHTHLCRLYMPAVAPNNSHSLPGKKNDFQEARKPTPLGSWNTFHKQGG
IGATVEKGEKGDPGQLGATGTVGVKGQKGDIGPPGPPGPGNMGLPGQKGEQGPEGKQGLP
GLQGLPGEPGSPGKDGVPGRDGPRGEKGDSGGAMGPQGLPGPKGEPGEPGGGSMTDGLTL
TRGSRGPKGERGLPGLPGEPGEKGEPGEVVVGSPGPMGPPGKPGTEGPRGPPGLSGSPGA
AGREGPPGRPGPPGPAGPPGEPTALPIVGDMGALLKNACSVCQTRVPGLPGQKGEKGSPG
EQGAQGLVGEKGDPGVRGPMGNPGKEGPKGVKGERGFPGPMGDKGDEGPAGVPGLPGVSG
RTGAPGLMGRPGPMGEPGKKGEKGNEGPPGTPGLPGPPGVPYVEGNGMSSLYKLQSSGVI
LGPPGAPGAPGLKGDNGPQGEPGSMGLPGLEGLPGAKGDTGLIGPPGLQGPPGKPGARGE
PGIPGEPGERGPLGETGFPGPEGPQGVAGRPGRDGTPGIKGVTGRAGDRGPKGERGDPGI
PGGRGVQGERGRVGDPGPVGPIGQKGEPGQLEDANLLVSCKFPGVLNHKQDDPGFMEELR
ILIRTEVLRIFEERMSSSVTLQKTPAGILASNGQGPPGPPGKDGFPGPPGVPGSPGPQGY
RGQKGERGQPGVGLPGDPGPMGPAGPPGISLKGPPGPPGPRGPPGTCNPADCLLP
Download sequence
Identical sequences H3DGN9
ENSTNIP00000019683 ENSTNIP00000019684 99883.ENSTNIP00000019683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]