SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019685 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019685
Domain Number 1 Region: 20-203
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.85e-19
Family Laminin G-like module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019685   Gene: ENSTNIG00000016583   Transcript: ENSTNIT00000019915
Sequence length 879
Comment pep:known_by_projection chromosome:TETRAODON8:17:3977129:3988077:1 gene:ENSTNIG00000016583 transcript:ENSTNIT00000019915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCPQSNNGKDYFPGFFIMSQFHIAELARRGTKKVNGSSRQQVAYQIGPAFNFRIRSRSAY
PLGLPEEFAFVAVLRMSGSSISKNWNIWQMQSADGEEQLAVRLYGETKSVEFAFTVPNAG
KRTVLFSQIDSLFNDLWHNLLLEVSRHGVTLFVDCHKIRSEKTPARQKVGLDGYTSIGKL
KDNPLIAIPFELQSMLIHCDLTRARADAWDLPARTSDKVDIFCSTQNSEGPPGPPGPAGV
PGINGIDGERGADGEEGLPGPDGDAGKPGSPGLPGNPGNDGLTGPIGEPGLDGLPGQKGE
PGKPGPRGAAGVGPDGPPGPPGPGGLLGEMGKSGPVGAMGVRGPQGPRGPTGPRGAAGML
GSSDLCPNSCPPGTPGHPGLPGMKGHKGVKGDAGEPGKQGHKGEEGEQGGPGEVGAQGPT
GPQGIRGATGLMGPKGEMGSRGLDGDPGPQGVAGAIGDGGQRGVMGEPGPPGEKGTQGPR
GITGVPGPKGEAGLPGVDGREGIPGMPGAKGSIGKAGAPGEIGPQGFPGLPGSPGPKGSS
GSKGDAGQPGLPGTIGSAGKPGERGEQGEVGPVGPIGEPGDIGQQGPRGPAGKPGARGPK
GDPGLPGIPGPPGSRGEKGERGESGEPGPKGDQGAQGDEGNPGDKGDVGEAGESGPKGEV
GNPGEPGNRGPEGNRGQSGIEGPPGTAGPRGMQGDRGAPGVRGTQGPPGKEPSDQHIKQV
CMRVMQEQLAQLAASLRRPETGVTGLPGKPGLPGPPGIPGDSGFPGHAGARGLPGLKGPP
GPLGKKGQKGEIGDRGSRGPTARGPKGQPGPPGLPGEPGKPGYGQDGRDGQRGRPGVPGL
PGVPGPPGAHGLNGYCDPSACNLQAGAAQQSLDVKGPAG
Download sequence
Identical sequences H3DGP1
ENSTNIP00000019685 99883.ENSTNIP00000019685 ENSTNIP00000019685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]