SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019695 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019695
Domain Number 1 Region: 946-1159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-102
Family Thrombospondin C-terminal domain 0.00000000542
Further Details:      
 
Domain Number 2 Region: 22-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-39
Family Laminin G-like module 0.0000219
Further Details:      
 
Domain Number 3 Region: 823-944
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.62e-37
Family TSP type-3 repeat 0.000000586
Further Details:      
 
Domain Number 4 Region: 754-825
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.16e-16
Family TSP type-3 repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 428-484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000127
Family TSP-1 type 1 repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 486-533
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000196
Family TSP-1 type 1 repeat 0.00019
Further Details:      
 
Domain Number 7 Region: 685-766
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000536
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 8 Region: 315-357
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000157
Family VWC domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019695
Domain Number - Region: 538-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00099
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019695   Gene: ENSTNIG00000016593   Transcript: ENSTNIT00000019925
Sequence length 1161
Comment pep:known_by_projection chromosome:TETRAODON8:17:3860759:3870041:1 gene:ENSTNIG00000016593 transcript:ENSTNIT00000019925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLASLIISFHPSFADGEQENETSFDLFEISHITRRTLGAKQFRGPNSDTPAYRFIRFDHL
PPVSTPILKQILRQMQYNEGFVFMASMRQDRTSRGTLIGFEGPNGQRQFEIVSNGRANSL
DLVYSVDGSQNIVQFEEVDLSDSQWKNITLHVHGENANLFVGCSLIDSFILDEPFYEHLQ
AEGSRMYVAKGSSRESHFRGLLQNVRFMFDTTVEDILLSRDCEVPKQDDGNIVRESTEIM
DVSPSITTNVIGQKTDEVGSNMCERSCEELSTMFQELNGLRVVVSNLIDGLQKVTEENMF
MKEALGKMKNSKEKNMCWQDGRLFEDKEDWIVDSCTKCTCQSFPVFQFKMDCSVAVTTEQ
SFYLEQGRPLSQIHNNPPERDQNYSKNPDLTVASSSQLVSVWRLNSCCTTLRNLTSSCSQ
CFFCHLVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNAPVPQLGGKDCEGNGRETQVCT
AEPCPIDGGWGPWSPWATCSVTCGGGVKTRTRECNSPQPQYGGRRCIGKASDSKKLCPID
GCLSNPCFAGVECNSSPDGSWDCGPCPAGFRGNGTNCHDMNECDMVSDVCYQVNGMQRCI
NTDPGFHCLPCPKRYKGNQPFGMGVEAAKKNKQVCEPENPCKDKTHNCHKHAECIYISHF
SDPMYKCECRTGYAGDGFICGEDSDLDGWPNQNLVCGTNATYHCKKDNCPSLPNSGQEDF
DRDGQGDACDKDDDNDGIPDETDNCGLLYNPRQFDFDKDEVGDRCDNCPYEHNPAQIDTD
HNGEGDACAVDIDGDGILNENDNCPYVYNTDQKDTDMDGVGDQCDNCPLLHNPDQTDVDN
DLVGDQCDNNQDIDEDGHQNNQDNCPYVANSNQADHDQDGKGDACDFDDDNDGIPDDRDN
CRLTPNADQLDSDGDGRGDACKDDFDNDSIPDILDVCPENNAISVTDFRKFQMVHLDPKG
TTQIDPNWVVRHQGKELVQTANSDPGIAVGFDEFNAVDFSGTMYVNTDRDDDYAGFVFGY
QSSSRFYVVMWKQITQTYWEDKPSKAFGISGVSLKVVNSSTGTGEHLRNALWHTGNTPGQ
VRTLWHDPKNIGWKDYTAYRWHLIHRPKTGFIRVVVYEGKQIMADSGPVYDKTFAGGRLG
LFVFSQELVFFSDLKYECRGA
Download sequence
Identical sequences H3DGQ1
ENSTNIP00000019695 99883.ENSTNIP00000019695 ENSTNIP00000019695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]