SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019699 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019699
Domain Number 1 Region: 473-679
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.29e-38
Family Laminin G-like module 0.00091
Further Details:      
 
Domain Number 2 Region: 691-882
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.32e-38
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 3 Region: 886-1066
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-35
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 208-234,276-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-32
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 5 Region: 26-191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-30
Family Laminin G-like module 0.0057
Further Details:      
 
Domain Number 6 Region: 1099-1239,1268-1312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.61e-29
Family Laminin G-like module 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019699   Gene: ENSTNIG00000016597   Transcript: ENSTNIT00000019929
Sequence length 1515
Comment pep:known_by_projection chromosome:TETRAODON8:17:3568382:3724426:-1 gene:ENSTNIG00000016597 transcript:ENSTNIT00000019929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQKLPGAQVFWVGLLVCCLAETAFCLEFPGAEGQWARFPVWNACCESEMSFNMKTKSA
HGLLVYFDDDGFCDFLELLILNGKLSLRFSIFCAEPATVVSEAAVNDSQWHTVTIRRNFK
NTTLTVDGESKWNEVTSKRRDMTVFSHMYVGGIPPELRSETLRLTSAVVKDQPPFTGWIT
DVKVNGTEPALIGSEEVLQDLCGTANMCLNGGVCSLINNEPTCDCAQTGFQGKDCSEEKE
SGGVEGLAHLMMGDQGGKKKKKKRVHGMLFLMRISTGKEEYVATFKGSEFFCYDLSSNPI
QSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGK
FNDNDWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFF
YVGGSPSTADLPGSPVSNNFMGCLKEVVYKNSDVRIELSRLAKLGDPKMKVQGTVAFKCE
NVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKSKQQPKDSKVP
QTPKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISINT
LRTAYTAPGESEILDLDDNLYLGGLPENKLGLVFPTEVWTALLNYGYVGCIRDLFIDGQS
KDVRRLAEIQKAAGVKPSCSKEPPKQCLSNPCQNNGVCREGWNRYVCDCSGTGYLGRSCE
REATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSGDTLRLELES
GRVRLTVNLDCMRINCTTTKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDDLPPVEG
QMAGDHTQLEFHNIETGIVTEKRFMSMVPSNFIGHLQSLSFNGMAYIDLCKNGDIDYCEL
NTMIGFKSIIADPVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSSDGLILFNSGDGNDFI
VVELVKGYLHYVSDLGNGAHLIKGNSNKPLNDNNWHNVIISRDTNNLHTVKIDTKVTTQT
TTGAKNLDLKGNLYIGGVAKGMYKDLPKLVHAKEGFQGCLASVDLNGRLPDLMSDALDCV
GQIERGCEGPSTTCQEDSCANQGVCLQQWEGFTCDCSMTTFGGPLCNDAGTTYIFGRDGG
LITYTWPPNDRPSTRADRLAIGFSTHLKDAVLVRVDSSSGLGDFLKLHIEKGNIAVVFNV
GTDDINIEETSKFVNDGKYHIVKFTRSGGNATLQVDDLPVIERYPTGHNDNERLAIARQR
IPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWERDRSRSFQGQLSGLYYNGLKVFNMA
AEGDPNIRIQGSVRLVGDSPSSITPQSSTTANRSETSTSIMEITTTTTTASSRRVKQTTP
REPQQPTDDVLVASAECPSDDEDIDPCEPSSGGLANPTGVGSKSYPGTSELFPESSSTTG
MVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGTVVKEKPANTVK
TSSKNKKNKDKEYYV
Download sequence
Identical sequences H3DGQ5
99883.ENSTNIP00000019699 ENSTNIP00000019699 ENSTNIP00000019699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]