SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019700 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019700
Domain Number 1 Region: 442-648
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.01e-38
Family Laminin G-like module 0.00091
Further Details:      
 
Domain Number 2 Region: 660-851
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.97e-38
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 3 Region: 855-1035
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.52e-35
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 193-418
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.04e-32
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 5 Region: 11-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-30
Family Laminin G-like module 0.0057
Further Details:      
 
Domain Number 6 Region: 1068-1208,1237-1281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-29
Family Laminin G-like module 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019700   Gene: ENSTNIG00000016597   Transcript: ENSTNIT00000019930
Sequence length 1484
Comment pep:known_by_projection chromosome:TETRAODON8:17:3568382:3724381:-1 gene:ENSTNIG00000016597 transcript:ENSTNIT00000019930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVCCLAETAFCLEFPGAEGQWARFPVWNACCESEMSFNMKTKSAHGLLVYFDDDGFCDF
LELLILNGKLSLRFSIFCAEPATVVSEAAVNDSQWHTVTIRRNFKNTTLTVDGESKWNEV
TSKRRDMTVFSHMYVGGIPPELRSETLRLTSAVVKDQPPFTGWITDVKVNGTEPALIGSE
EVLQDLCGTANMCLNGGVCSLINNEPTCDCAQTGFQGKDCSEEKESGGVEGLAHLMMGDQ
DKVSTGKEEYVATFKGSEFFCYDLSSNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVN
LALKNGAVSLVINLGSGAFEALVEPVNGKFNDNDWHDVKVTRNLRQHSGIGHAMVNKLHC
SVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKN
SDVRIELSRLAKLGDPKMKVQGTVAFKCENVATLDPITFETPESFIVLNKWNAKKTGSIS
FDFRTTEPNGLLLFSHGKSKQQPKDSKVPQTPKVDFFAIEMLDGHLYLLLDMGSGTTKTR
AVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKLG
LVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRRLAEIQKAAGVKPSCSKEPPKQCLSNP
CQNNGVCREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSL
RFRSQRAYGILIATTSRDSGDTLRLELESGRVRLTVNLDCMRINCTTTKGPETIFAGQNL
NDNEWHTVRVFRRGKSLKLTVDDLPPVEGQMAGDHTQLEFHNIETGIVTEKRFMSMVPSN
FIGHLQSLSFNGMAYIDLCKNGDIDYCELNTMIGFKSIIADPVTFKSRSSYVTLTTLQAY
YSMHLFFQFKTTSSDGLILFNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKPLN
DNNWHNVIISRDTNNLHTVKIDTKVTTQTTTGAKNLDLKGNLYIGGVAKGMYKDLPKLVH
AKEGFQGCLASVDLNGRLPDLMSDALDCVGQIERGCEGPSTTCQEDSCANQGVCLQQWEG
FTCDCSMTTFGGPLCNDAGTTYIFGRDGGLITYTWPPNDRPSTRADRLAIGFSTHLKDAV
LVRVDSSSGLGDFLKLHIEKGNIAVVFNVGTDDINIEETSKFVNDGKYHIVKFTRSGGNA
TLQVDDLPVIERYPTGHNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQI
GGWERDRSRSFQGQLSGLYYNGLKVFNMAAEGDPNIRIQGSVRLVGDSPSSITPQSSTTA
NRSETSTSIMEITTTTTTASSRRVKQTTPREPQQPTDDVLVASAECPSDDEDIDPCEPSS
GGLANPTGVGSKSYPGTSELFPESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSY
HVDESRNYISNSAQSNGTVVKEKPANTVKTSSKNKKNKDKEYYV
Download sequence
Identical sequences H3DGQ6
ENSTNIP00000019700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]