SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019714 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019714
Domain Number 1 Region: 79-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 220-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000538
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 137-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000748
Family EGF-type module 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019714
Domain Number - Region: 193-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00107
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019714   Gene: ENSTNIG00000016609   Transcript: ENSTNIT00000019944
Sequence length 438
Comment pep:known_by_projection chromosome:TETRAODON8:17:3321968:3329045:-1 gene:ENSTNIG00000016609 transcript:ENSTNIT00000019944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLSPRRSFTCIGILACALVLPPQTCMDKHQVVGVLRQMEKFLKGQEMRFTEGLRIMKS
KLATLQNSVSKMPQAAPTSCPPLGAPAFGTKFGSKHFVGHEVHFTCSQGYHLAGSATRVC
QDNGTWSGVSTVCKVMSQCASNPCQNGGTCVAGLNQYRCTCPQRWSGSHCQHPTQTAPPE
WSVVNDPAFSRRPRCAQVNQEQHCSCDAGFHMSGTTDSSICQDVNECEVYRLDRGGKLCL
HECVNVPGSYRCSCPSGYKLLPDGRSCEDVDECLSQQHNCSRGTTCINTGGGFQCVSPEC
PRSHGNTSYVKTSPFQCERNPCPMDSRSCHLSPKTMSFHYLSLPSNLKTPATLFRMATAA
APGHAGPDSLRFGILGGNSRGFFIMQRSDRQTGELILVQPLRGPQEVSVDVDMSEYSERI
FQAKHVARVHVFVSPYNF
Download sequence
Identical sequences H3DGS0
99883.ENSTNIP00000019714 ENSTNIP00000019714 ENSTNIP00000019714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]