SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019738 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019738
Domain Number 1 Region: 29-167
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000209
Family PX domain 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019738
Domain Number - Region: 201-398
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000296
Family BAR domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019738   Gene: ENSTNIG00000016632   Transcript: ENSTNIT00000019968
Sequence length 402
Comment pep:known_by_projection chromosome:TETRAODON8:17:2952427:2956357:1 gene:ENSTNIG00000016632 transcript:ENSTNIT00000019968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAVMTSSIDESSKEKMRSVSVDLNNDSSLLIDIPDALCERDKVKFTVHTKTTLSSFQKPE
FSVPRQHEDFIWLHDTLVETEDYAGLIIPPAPPKPDFESPREKMHKLGEGEATMTKDEYT
KMKQELEAEYLAVFKKTVQVHEVFLQRLSSHPILSKDRNFQIFLEYDQDLSVRRKNAKEM
FGGFFKNMVKSADEVLISGIKEVDEFFEQEKTFLLDYYSKIKDSTAKAEKMTRAHKNIAD
DYILISATLNCLSADDSTANKKQLEKLSDLFEKLRKVEGRVASDQELKLTELLRYYMRDI
QAAKDLLYRRARALADYENSNKALDKARLKSKDIPQAEEHQKHCLQKFDKLSESGKRELT
GFKARRVVAFRKNLIEMAELEIKHAKNNAALLQGCIDTLKSN
Download sequence
Identical sequences H3DGU4
ENSTNIP00000019738 99883.ENSTNIP00000019738 ENSTNIP00000019738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]