SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019756 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019756
Domain Number 1 Region: 339-547
Classification Level Classification E-value
Superfamily vWA-like 8.76e-50
Family Integrin A (or I) domain 0.00049
Further Details:      
 
Domain Number 2 Region: 162-355
Classification Level Classification E-value
Superfamily vWA-like 4.3e-44
Family Integrin A (or I) domain 0.00074
Further Details:      
 
Domain Number 3 Region: 32-126
Classification Level Classification E-value
Superfamily LCCL domain 4.05e-27
Family LCCL domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019756   Gene: ENSTNIG00000016649   Transcript: ENSTNIT00000019986
Sequence length 553
Comment pep:known_by_projection chromosome:TETRAODON8:17:2251227:2261179:-1 gene:ENSTNIG00000016649 transcript:ENSTNIT00000019986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSFLWTPNCSSGVTVNVQIWRHPCFAPSAVIPAIECDVRAGKINLPEFIAKCPAHCKESK
QQVYGTGVFASISSICNAAIHSGVITNAGGKVIVKKMAGQNIYKGSNSNGVRSLSLPKWR
ESFVVSASDASTFSAVRSDVSYAAPDSGYTWTETDTPEITVKKCKIDLVFLMDGSWSIGK
RRFKIQKDFLAEVAQAINVGPTGPMMGVVQYGDDPVTEISLKSVSSSREARSAVEKITQK
GGLSHVGRALSYINKQYFSDANGNRGAAPNVAVVLVDGWPTDKVEEASRLARESGINIFF
VTIEGPDGLEKQKVVEHDFVDKAVCRTSGFFSLPVSSWFALRKLVQPLVKRVCDTDRLVC
SKTCLNANDIAFVIDGSSSVGTGNFRTVLQFVANITREFEISDTDTRVGAVQYTYEQRLE
FSFSQYGNKADLLGAIKRISYWSGGTSTGAAISYASEQLFSKSKPNKRKIMIVITDGRSY
DDVRQPAAAVHRQGQRCDHLLRGHRWAAQDELEYIATDPDAEHSFFVDEFDNLYKFVPRI
VSNICQEFNSQPR
Download sequence
Identical sequences H3DGW2
ENSTNIP00000019756 99883.ENSTNIP00000019756 ENSTNIP00000019756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]