SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019769 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019769
Domain Number 1 Region: 15-57
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000000159
Family MYND zinc finger 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019769   Gene: ENSTNIG00000016662   Transcript: ENSTNIT00000019999
Sequence length 351
Comment pep:known_by_projection chromosome:TETRAODON8:17:1981607:1988979:1 gene:ENSTNIG00000016662 transcript:ENSTNIT00000019999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAAHMEKKQGDAERERQYCELCGKMENLLKCGRCRSSFYCSKEHQKQDWKKHKLSCKEPQ
LPSQKPGHTQPTGGDAKIPSGRADSASPSAAKAPGVGDRQGEDGASEGSTPNGQSSPSPQ
KLAAECIVPCMNKHGICVVENFLGAEVGQSVLDNVKALHHTGRFSDGQLVSQKGDSTKDI
RGDQITWIEGKEAGCEKIRFLMGRMDDLIRHCNGKLGNYSINGRTKAMVACYPGNGTGYV
RHVDNPNGDGRCVTCIYYLNKDWNAKDHGGLLRIFPEKAQFADIEPKFDRLLLFWSDRRN
PHEVQPAYATRYAITVWYFDGDERARAKEKYLTNAGEKGVKVELGKPSDPS
Download sequence
Identical sequences H3DGX5
ENSTNIP00000019769 ENSTNIP00000019769 99883.ENSTNIP00000019769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]