SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019805 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019805
Domain Number 1 Region: 53-518
Classification Level Classification E-value
Superfamily Sema domain 9.29e-147
Family Sema domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 514-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000148
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019805   Gene: ENSTNIG00000016697   Transcript: ENSTNIT00000020035
Sequence length 1020
Comment pep:known_by_projection chromosome:TETRAODON8:12:9384424:9427603:1 gene:ENSTNIG00000016697 transcript:ENSTNIT00000020035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEALLLYFTLLQIAGAGFPEDSEPISISHSNYTKQYPAFVGHKPGRNNTQRHKLDIQL
IMIMNRTLYIAARDHIYTVDTDADGSDEIFFSKKMTWKSRQADVDTCRMKGKHKDECHNF
IKVLLQQNDDALFVCGTNAFNPSCRTYKTDTLEALGEEISGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKAEPYFVQAVDYGDFIYFFFREI
AMEYNTMGKVVFPRVARVCKNDRGGSPRVLEKQWTSFLKSRLNCSIPGDSHFYFNILQAV
TDVIHINGKDVVMATFSTPYNSIPGSAVCAYDMVEVANTFTGRFKEQKSPDSTWTPFPEE
KVPKPRPGNCAGTPSMERYKVSNEFPDDTLNFIKMHPLMDEAVPSIANRPWFLKTMVRYR
LTRIVVDNEAGPYKNHTVVFLGSEKGIILKFLANMNNGFLNDSVFLEELNVYNPDKCSID
GVDDKRIVGMQIDGKSHSLWVAFTSCVVKVPLSRCERHGRCKKSCIASRDPYCGWVAEGA
CRKVVGNIKSAFEQDVERGNTDGLRDCQNTFVALNGHHHRHHHHTLSLPTSALPEAAEGP
LGRGRMVEQKELPMSSDNGEDPYIARALSDSARSQCKGVIRESYQKGRDQLVPVTLLAIA
VILAFAMGAIFSGIIVYCVCDHRRRDVDMTGHKEKESHHLHARRGSMNSVTKLTGLFETQ
AKDGRPEAILTPLMHNGRLTPNGKMLIKADQHHLDLAALPTPESTPMQPRRKPSRGSREW
ERNQNLINACTKDMPPIGSPVISTDLPLRASPGHIPSVVVLPLPQHQHQLQPHLQSYQHE
YVEQPHHSELSMAHGVMDDQGATLEYKTIKKPCHNLNLVDPDGVLPPRVPQREASLTVPP
AVPQMGKRLEVHSSVYGLRKGSASSASGSSALKKHNTNSSNSSQLARQHSFNRVETPPPA
PQRVDSIQMTAQGISLSRQPGMSSYGSLPRTGIKFLRPDVPPKPSVVSLSTKVKSSDSCT
Download sequence
Identical sequences H3DH11
99883.ENSTNIP00000019805 ENSTNIP00000019805 ENSTNIP00000019805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]