SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019822 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019822
Domain Number 1 Region: 37-215
Classification Level Classification E-value
Superfamily vWA-like 5.4e-36
Family Integrin A (or I) domain 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019822   Gene: ENSTNIG00000016713   Transcript: ENSTNIT00000020052
Sequence length 486
Comment pep:known_by_projection chromosome:TETRAODON8:12:9737941:9759530:1 gene:ENSTNIG00000016713 transcript:ENSTNIT00000020052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGAQKELRARGRWSSAALAALLLCVFASSSWAEEASCHGAYDLYFVLDKSGSVAGDWGEI
YSFVKNLTDRFVSPRMRVSFIVFSAQAKVLLPLTGDSYKIKEGLRKLYDVKPAGETFMHV
GIKEASVQIRAQPSPTSSIILALTDGKLEVYVHDLTVKEANEARKYGARVYCVGIKDFDE
QQLANIADTKDQVFPVKDGFHALKGIVNSILKRSCTEILSVEPSSVCVNETFDIVLRGNG
FTLGRTNEAVVCSFIMGQRTFNHKPSTVRDDYMLCPAPELYEEGQTMDVLISLNHGKTFI
SGSHTITASACSSGWAVAIVFLVLLILVALALMWWFWPLCCKVACRWPPPPPPLNDRRRS
TERLPSDQSWRRLSFLYAAGRGRIILKSCSVRWGEKGSTEEGARLEKAKNAVVTVPEEEP
ELPQSRRSAATAPRYHRNQNKWYTPIKGRLDAVWALLRRQYDRVSLMRPTSEDKNEAFNY
YRVPSA
Download sequence
Identical sequences H3DH28
ENSTNIP00000019822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]