SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019851 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019851
Domain Number 1 Region: 259-452
Classification Level Classification E-value
Superfamily Nudix 1.49e-40
Family NADH pyrophosphatase 0.0016
Further Details:      
 
Domain Number 2 Region: 21-102
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-16
Family Ankyrin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019851   Gene: ENSTNIG00000016741   Transcript: ENSTNIT00000020081
Sequence length 458
Comment pep:known_by_projection chromosome:TETRAODON8:12:10215798:10218131:-1 gene:ENSTNIG00000016741 transcript:ENSTNIT00000020081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASMTSLQLRAGEEAVRRFLEAAARGDLPQLRLLLSGTPELLNRTGDSGWTALMLAARNG
HYQVAEALLSHGCDKLSVNSSSQTAYDVAKFWGHKHISNLLARTDDGCNQALPGSDRLQP
ELYFSRETLDRQSGKRTDKVWLEARQCHHNTVYLLFSHLAPMVSSSQNDESSKVLTKLCR
FSYDAVRDLVQKPTTKLVFLGVEKKKASSSQEREGFWEPPAWFAIGTEEDAAELLKRCAE
KNCYFPKSPNRDLLKFSEEEAGIVAQARSVLAWHDRYGFCPTCGSGTSLEEGGYKRSCLD
SDCRSLQGVHNTCYPRVDPVVIMLVVHPDGNQCLLGRKKTFPVGMFSCLAGFIEPGEAIE
DAVRREVEEESGVKVGPVRYVCCQPWPMPSNLMIGCLAVATSTDITADQNEIEEARWFTR
QQAIESLHGGARPAMTAPPSQTIAHQLIRYWIGMNANL
Download sequence
Identical sequences H3DH57
ENSTNIP00000019851 ENSTNIP00000019851 99883.ENSTNIP00000019851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]