SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019867 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019867
Domain Number 1 Region: 280-408
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000048
Family Ankyrin repeat 0.0037
Further Details:      
 
Domain Number 2 Region: 4-50
Classification Level Classification E-value
Superfamily LEM domain 0.0000000012
Family LEM domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019867
Domain Number - Region: 161-199
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0068
Family N-terminal domain of RNase HI 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019867   Gene: ENSTNIG00000016757   Transcript: ENSTNIT00000020097
Sequence length 912
Comment pep:known_by_projection chromosome:TETRAODON8:12:10813572:10818213:1 gene:ENSTNIG00000016757 transcript:ENSTNIT00000020097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMEATLTRLGSLTADELREEFARAGVKCGPITPTTRATFERKLARVLAGTANTSAEHDSS
ASVDISDSSNSTAGHTSVGAVSPAFAAASRKLTEKGYEDVDFGYGVGLNPPDEEEVSEKS
SKSFTEVSNSQNITETPSKQTQVSPTLYYGVCPPWHDVLARSERAHVFTDRKDALQAVKT
MKGARFKAFSIREDAEKFARGICDYFLSPSKTVSCVSPAKPGTVLSKGGLISPKDNMEVD
TINRERANSFKSPRTQDLTAKLRKAVEKGDREAFSELVWTNPRYLIGSGDNPTIVQEGCR
YNVMHVAAKENQAGIAQLLLDTLENPDFMRLMYPDDQEGMLQKRIHYIVDLYLNTPDKAG
FETPLHFACKFGCPDVVNVLCSHPDIDKSCRNKDGQRPCDLICSRKNKTHEVKQKIAEFL
EDRFYIPLLRATDNSSQPVIGALWSPESSERLLLLPQHGRSPIDPVMAVSAFAGPLSPSK
ADDFRRSWKTPPREQAQHIHNILKSDPDRGAERVGRDLARGMGAPWAEFWDFLDSFVDLS
STEGLRKLEEYLSKRDFSPQSHEDTGENESSNRFRTPSPGKHKKFCNSISVGAFLEEGDD
ISLEEMKNRQNAALTSITFSAGSKDGLKGAVGGRESHILPIARHHHGADLIETAAEQGLL
CCCSDSLLSPGNTCKNCASSSRDRTHNGDKMAPRTPPSSSTMLSPVSNLLVEFERMSLEE
TLDSPSSCRERKSSGGNRHRESWDAYGSASATDLGLHRFSLGHSPPERMEERSSSEGSEY
FEAEESVEGFGRTRGAVSSVRGICARSSPTKLDQEVLLAIEGVDIDPQMYPSIQKWKSTI
KTYSPSDMKSWPSPAVVKSRLRMQTPGSPVSGLMSPSGRFSPARHAPSPDFSPSRYSPAN
ASYIQRIRLKHL
Download sequence
Identical sequences H3DH73
ENSTNIP00000019868 99883.ENSTNIP00000019867 ENSTNIP00000019867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]