SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019892 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019892
Domain Number 1 Region: 477-657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-43
Family SPRY domain 0.0024
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.51e-16
Family B-box zinc-binding domain 0.0000271
Further Details:      
 
Domain Number 3 Region: 374-482
Classification Level Classification E-value
Superfamily Fibronectin type III 7.53e-16
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 4 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000172
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019892
Domain Number - Region: 112-162
Classification Level Classification E-value
Superfamily RING/U-box 0.00247
Family RING finger domain, C3HC4 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019892   Gene: ENSTNIG00000016779   Transcript: ENSTNIT00000020122
Sequence length 690
Comment pep:known_by_projection chromosome:TETRAODON8:1:7885241:7930357:1 gene:ENSTNIG00000016779 transcript:ENSTNIT00000020122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCSSSKPLESISAFQCPTCR
YVITLNHRGLEGLKRNVTLQNIIDRFQKASLSGPNSPTESRRLQQQRPYTATISARISCQ
FCEQDPPREAVKTCVTCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHIRGLTCLEHEN
EKVNMYCLVDDQLICALCKLVGRHREHQVSSLTERFDKLKQTLENNLTNLVKRNSELENQ
MAKLIQICQQVEVNTAMHEAKLVEECDELVEIIRQRKQVIAVKIKESKVMKLRKLAQQIA
NCRQCLERSSALITQAEQSLKENDHARFLQTARNVAERVAMATASSQVLIPDVNLNEAFD
NFALDFSREKKILEGLDYLTAPNPPTIREELCTASHDTITVHWTSEDEFSVTSYELQYTI
YTGQTNFISLYNSADSWMIVPNKQNHYTVHGLQSGTRYIFFVKAINQAGSRNSEPARLKT
NSQPFKLDPKTAHKKLRLSNDCLTMEKDESSLKKSHTPERFSGTGSYGAAGNVFIDSGCH
YWEVLLGASTWYAIGVAYKSAPKNEWSGKNSSSWVFTRCNNNFLVRHDGKEMLVEASLQL
RRLGVLLDYDNNSLSFHDAMNSQHIHTFEISFLLPVVPTFMIWNKSIMILSGLPVPDFVD
GVPTDFQEQQQQMGLCRQESPYLTGMKTCH
Download sequence
Identical sequences H3DH98
ENSTNIP00000019892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]