SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019907 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019907
Domain Number 1 Region: 154-292
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.88e-25
Family UBX domain 0.025
Further Details:      
 
Domain Number 2 Region: 4-55
Classification Level Classification E-value
Superfamily UBA-like 9.57e-17
Family UBA domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019907   Gene: ENSTNIG00000016793   Transcript: ENSTNIT00000020137
Sequence length 293
Comment pep:known_by_projection chromosome:TETRAODON8:1:8095813:8098014:1 gene:ENSTNIG00000016793 transcript:ENSTNIT00000020137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEQTTLESLLEMGFERNKAEKAVAYTGNQGIEQAMDWLMEHDDDPDIDEPYVPPAENVL
GGKSENQPAPEEPTLADTAEENARTPLTEEEKLEQVKRLEELMRVKQAERREREQKEELE
REIQRRKQGQELQKVRQKLQDDEMKKLAELRRREKMEEKLARQRVKEKIARDREERAQKF
GGSGQSSSSSSQPGQPSPSSPTSHGPPPTKKEYDESRIQVRLLDGSTITTVFKALEPLAA
VRVYVQMNSNVPEGQDFTLLSPYPRHVYTEQDMEKPLKELGLVPSAVLVVAKK
Download sequence
Identical sequences H3DHB3
ENSTNIP00000019907 ENSTNIP00000019907 99883.ENSTNIP00000019907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]