SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019994 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019994
Domain Number 1 Region: 831-1120
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.73e-79
Family Complement components 0.0000152
Further Details:      
 
Domain Number 2 Region: 1204-1322
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.28e-27
Family Alpha-macroglobulin receptor domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019994
Domain Number - Region: 668-720
Classification Level Classification E-value
Superfamily E set domains 0.0546
Family Arrestin/Vps26-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019994   Gene: ENSTNIG00000016878   Transcript: ENSTNIT00000020225
Sequence length 1323
Comment pep:known_by_projection chromosome:TETRAODON8:10:2927618:2934672:1 gene:ENSTNIG00000016878 transcript:ENSTNIT00000020225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVVTGPAALHPGVPTSLAVTVLADFPGKVVAEVAHGNTKSLLFNSQICLRPEIPLLLQVY
GPLTPSVLSNLTVRGYRGDSLVFSNSTALPFSLRNVSSFIQTDRSCYQPGETVRVRVVSL
RLDQRPHKGRVETRVLDPSGTAVDGREATGTLGMVLWEFSLSQMAPLGQWTITASANGVT
DERTFTVEDHERPPFEMLFKTPPRVLVGDALSGSVRVLYPSGPPVHGTLVVSVSLASASV
PAQTKEVRLQIYGSTQFFFGKDLLQSLYSSPGISGGSLRVTAGVTDSSTGTRRLKVTKTV
EVQVEEHQFLLQFHQFPSSLKPSLYFYSTLSIQRYDSGPLGSEDRMHPAVIEVTQELTTM
KAEAAILTLPVPEDGNVHFSFRLKQEVLKLVIRAKFQSSEQTLRVYRNYSSPTGSYVQVS
ADTLPAQIGVPLQLHVESSFQWSELHYVVSSRGLLLAAGTKNSSWFSLTPSVSWSPEACV
TVYCVRSDGELISDTVAVPTDQPNQASLEWSSPQARPGEQVALTVTAAEARFQVGVVVMG
VSVSLLPQRCSLRMLTNAMLQKQAQAEGPDGMVSKKPPLIRSLNVWGLLGFKFSSSGSEE
GDFLTIETSWRRWMEDAETLLWIDSDVSENIWTSDKMSVPDGFTALRAVALVMSDNLGLG
FTPVPQQLSVTKDFSLALNVPSCLIRGEEIVLEVHVINHLERQMEVILLLAESETFQFVL
ANRADASVVNAQKLTLGSHVSAVALFPVRPVALGPMDITVDAVSAEASDSLVWSVFVKPG
GVEQSFSKTLFLELPPSNHSISRSVSFSSPPHVVAGSRRTFVAYAGDILALSISHLDSLV
QRPLGCGEQNMIHFAPSIYVLLYLDKSTQDNQELRSQAVAYLKEGYLRQLSYQREDGSFS
AFGARDPSGSTWLTAFVLRCFLQAQAYMMVSQSVLTRAVTWLLEHQGPRGDFGEVGRVIH
TEMQAGLDDAPAALTAFVLIALLEDERYTGNVSLAQRYLEDKVSGGGLSNYSMCLAAYAL
ALANSPQAGRALDELRRRADLIDGVMMWSSSAGPPSPDWPPRSAQVEMTAYVLLAFYRLG
NLVEGIGLMKWLSEQRNHLGSFGTTQDTIVALQALAYYAAFSGAKAIDLGLSVSTPTSPL
VSQLHINSTNFLAYQSQEIDAAQDVNLNIYMEGRGFVIFQLNIFYNLDSRAFMQSLHDAA
EEEAFSLDVAVTLEADQNHMLLSICTRLQESQVVRQTGMVMVEAGLLSGFRLSPGALPPG
SPLRNVEAQEDKVTLYLDSVNRTEVCIRLPLLRAHKVARVQDAVVQVYDYYEPTRRATRA
YNS
Download sequence
Identical sequences H3DHK0
ENSTNIP00000019994 ENSTNIP00000019993 99883.ENSTNIP00000019994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]