SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020003 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020003
Domain Number 1 Region: 538-665
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-32
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.71e-18
Family SAM (sterile alpha motif) domain 0.0045
Further Details:      
 
Domain Number 3 Region: 214-297
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000907
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020003   Gene: ENSTNIG00000016886   Transcript: ENSTNIT00000020234
Sequence length 942
Comment pep:known_by_projection chromosome:TETRAODON8:10:3134618:3165031:-1 gene:ENSTNIG00000016886 transcript:ENSTNIT00000020234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPAMEPITRWTPKQVVDWMKGLDDSLQQYVSNFEREKISGEQLLKITHQDLEELGLARI
GHQELVLEAVDLLCALNYGVETDNLKGLVVRMRAATSNLQKAISERRASPTYDGGTSRNP
NDFLTSVVELIGAAKSLLAWLDRTPLTGISDFTTTKNKIIHLCLELTTTVQQDCSVYEME
EKILEVSKILSSICDQTVRTTSDPLMSQSACLQEVQLANIKPGEGLGMYIKSTYDGLHVI
TGTTEHSPADLTRRIHAGDEVIQVNLQTVVGWQLKNLVVKLREDPKGVILLLKKRPTSTT
GFTPAPLKNMRWKPPVQQVVLNNSSLIRTQSPSGSANKLAKKEKPAILDLYIPPPPPVPY
APREVRMDTVSSISQRPKGSESPNSFLDLENRRRTVTDYDKLNFGCPIEANVIQPKMREP
KPSRGKPRPISMPADTCLRVTDPYARPWAQGRKGEDLLYRYLSNERIPTIAEELPSVSPP
YRPAGERHLIRVDHIRGNRYFSNSDLHNSATIPYQEDARKAPVAPVTKRTSAERSLLVSL
RHKSKKKTRGGNGTMSRRRISVKELGQPDYQGWLYRKKESKGFLGMKWKKYWFVLKKTSF
YWYSNQQAEKAEGYINLTNFVIDRAIECKKKHAFKACHPQVMMFYFAAESHEDMNLWLNK
LGLASIQYEPAAVNPATECYSESSDHEEAESTEAPPPPYTDQTLQGSGGAPGPPGGTHQG
TLPPPYSSAAPVAANGSLSSPVSTMTSHSSSSSLAKQRQSWLDLVSQAPPVAVETAVVCS
VQVHTHRPPAEEARSEALETSSQPDSLEMQYNEENGGDEEEEAQTASSEAGGERVTFKIR
GNHVNVSDEMEKLYIHLKEASLSPIGDRKPSTKREFRASFIKRCKNHVVNDRLHRIRTLN
STLKAKEADLHVIEQILADQALTADKFRGWKEANVALVQDIC
Download sequence
Identical sequences H3DHK9
99883.ENSTNIP00000020003 ENSTNIP00000020003 ENSTNIP00000020003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]